Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 2939248..2939773 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | N1NPN2 |
Locus tag | XNC2_RS12330 | Protein ID | WP_010848883.1 |
Coordinates | 2939248..2939532 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | N1NTS9 |
Locus tag | XNC2_RS12335 | Protein ID | WP_010848882.1 |
Coordinates | 2939522..2939773 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS12310 | 2934727..2935659 | + | 933 | Protein_2444 | IS66 family transposase | - |
XNC2_RS20880 | 2935801..2936922 | + | 1122 | Protein_2445 | ISAs1 family transposase | - |
XNC2_RS12320 | 2937284..2937820 | + | 537 | WP_013184731.1 | gluconokinase | - |
XNC2_RS12325 | 2937820..2939157 | + | 1338 | WP_010848884.1 | gluconate transporter | - |
XNC2_RS12330 | 2939248..2939532 | - | 285 | WP_010848883.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XNC2_RS12335 | 2939522..2939773 | - | 252 | WP_010848882.1 | plasmid stabilization protein | Antitoxin |
XNC2_RS23495 | 2939854..2940180 | - | 327 | WP_050986632.1 | hypothetical protein | - |
XNC2_RS12345 | 2940487..2941575 | - | 1089 | WP_013184732.1 | DUF459 domain-containing protein | - |
XNC2_RS12350 | 2941562..2942979 | - | 1418 | Protein_2452 | MBOAT family protein | - |
XNC2_RS12355 | 2943172..2943948 | - | 777 | WP_010848877.1 | protein bax | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10934.63 Da Isoelectric Point: 10.2279
>T285556 WP_010848883.1 NZ_LN681227:c2939532-2939248 [Xenorhabdus nematophila AN6/1]
MTYSLKFEKRALKEWEKLGHPIREQFKKKLSERLENPHISSARLSGRNNLYKIKLCSSGYRLVYEVNDHAIVLLVIAVGK
RSGNQVYSVADERE
MTYSLKFEKRALKEWEKLGHPIREQFKKKLSERLENPHISSARLSGRNNLYKIKLCSSGYRLVYEVNDHAIVLLVIAVGK
RSGNQVYSVADERE
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|