Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 403201..403787 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | D3VIJ6 |
Locus tag | XNC2_RS02035 | Protein ID | WP_013183288.1 |
Coordinates | 403458..403787 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | D3VIJ5 |
Locus tag | XNC2_RS02030 | Protein ID | WP_013183287.1 |
Coordinates | 403201..403458 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS01995 | 398360..399097 | + | 738 | WP_013183284.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
XNC2_RS02000 | 399295..399693 | + | 399 | WP_010845247.1 | 30S ribosomal protein S6 | - |
XNC2_RS02005 | 399699..400016 | + | 318 | WP_010845246.1 | primosomal replication protein N | - |
XNC2_RS02010 | 400021..400248 | + | 228 | WP_010845245.1 | 30S ribosomal protein S18 | - |
XNC2_RS02015 | 400287..400739 | + | 453 | WP_013183285.1 | 50S ribosomal protein L9 | - |
XNC2_RS02020 | 400874..401791 | - | 918 | WP_013183286.1 | glycerophosphoryl diester phosphodiesterase | - |
XNC2_RS02025 | 402346..402966 | + | 621 | WP_010845240.1 | peptidylprolyl isomerase | - |
XNC2_RS02030 | 403201..403458 | + | 258 | WP_013183287.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
XNC2_RS02035 | 403458..403787 | + | 330 | WP_013183288.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
XNC2_RS02040 | 403957..404700 | + | 744 | WP_010845236.1 | 3'(2'),5'-bisphosphate nucleotidase CysQ | - |
XNC2_RS02045 | 404792..405349 | - | 558 | WP_010845235.1 | YtfJ family protein | - |
XNC2_RS02050 | 405676..405882 | + | 207 | WP_010845234.1 | DUF1107 domain-containing protein | - |
XNC2_RS02055 | 405997..407328 | - | 1332 | WP_010845233.1 | hemolysin family protein | - |
XNC2_RS02060 | 407414..408061 | - | 648 | WP_013183289.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12349.57 Da Isoelectric Point: 9.9619
>T285549 WP_013183288.1 NZ_LN681227:403458-403787 [Xenorhabdus nematophila AN6/1]
MYIPDKGDIVSLNFDPSAGKEIMKRRPVFVISRKMFNERTGFAVVVPITSTARGMKLEVVLPEEVSVQGSILIHQVKSLD
FSERQVKFIEKAPQYIIDRVTELTKAIIL
MYIPDKGDIVSLNFDPSAGKEIMKRRPVFVISRKMFNERTGFAVVVPITSTARGMKLEVVLPEEVSVQGSILIHQVKSLD
FSERQVKFIEKAPQYIIDRVTELTKAIIL
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|