Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 349498..350147 | Replicon | chromosome |
| Accession | NZ_LN681227 | ||
| Organism | Xenorhabdus nematophila AN6/1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D3VI06 |
| Locus tag | XNC2_RS01795 | Protein ID | WP_013183266.1 |
| Coordinates | 349722..350147 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | N1NH79 |
| Locus tag | XNC2_RS01790 | Protein ID | WP_010845293.1 |
| Coordinates | 349498..349725 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XNC2_RS01775 | 345259..345975 | + | 717 | WP_013183262.1 | 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB | - |
| XNC2_RS01780 | 346022..348196 | + | 2175 | WP_065814196.1 | DNA helicase II | - |
| XNC2_RS01785 | 348285..349235 | + | 951 | WP_010845294.1 | magnesium/cobalt transporter CorA | - |
| XNC2_RS01790 | 349498..349725 | + | 228 | WP_010845293.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| XNC2_RS01795 | 349722..350147 | + | 426 | WP_013183266.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| XNC2_RS01800 | 350282..351172 | - | 891 | WP_010845291.1 | EamA family transporter RarD | - |
| XNC2_RS22555 | 351460..351618 | - | 159 | WP_113935524.1 | hypothetical protein | - |
| XNC2_RS01805 | 351667..352152 | - | 486 | WP_013183267.1 | thioesterase family protein | - |
| XNC2_RS22020 | 352335..353072 | + | 738 | Protein_345 | phospholipase A | - |
| XNC2_RS01815 | 353201..355027 | + | 1827 | WP_013183268.1 | ATP-dependent DNA helicase RecQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15366.95 Da Isoelectric Point: 9.2397
>T285548 WP_013183266.1 NZ_LN681227:349722-350147 [Xenorhabdus nematophila AN6/1]
MKTVYMLDTNICSFIMREQPVAVIKQLQRCVMNNHLIVVSAITYAEMRFGAVGKKASPKHIVLVDEFCRRLDKILPWDKS
AVDATTKTKIALAAAGTPIGHNDAAIAGHALSVGATLITNNSREFSRVTGLSLEDWANGLI
MKTVYMLDTNICSFIMREQPVAVIKQLQRCVMNNHLIVVSAITYAEMRFGAVGKKASPKHIVLVDEFCRRLDKILPWDKS
AVDATTKTKIALAAAGTPIGHNDAAIAGHALSVGATLITNNSREFSRVTGLSLEDWANGLI
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|