Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 82779..83325 | Replicon | chromosome |
Accession | NZ_LN681227 | ||
Organism | Xenorhabdus nematophila AN6/1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | N1NNP2 |
Locus tag | XNC2_RS00375 | Protein ID | WP_010847542.1 |
Coordinates | 83020..83325 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | XNC2_RS00370 | Protein ID | WP_173363083.1 |
Coordinates | 82779..83018 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XNC2_RS00345 | 79024..79764 | - | 741 | WP_010847535.1 | transferrin-binding protein-like solute binding protein | - |
XNC2_RS00350 | 80397..81161 | + | 765 | WP_013183068.1 | hypothetical protein | - |
XNC2_RS00355 | 81167..81997 | - | 831 | WP_013183069.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
XNC2_RS00360 | 82146..82346 | + | 201 | Protein_67 | hypothetical protein | - |
XNC2_RS00365 | 82355..82696 | + | 342 | WP_081480159.1 | formate dehydrogenase subunit gamma | - |
XNC2_RS00370 | 82779..83018 | + | 240 | WP_173363083.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
XNC2_RS00375 | 83020..83325 | + | 306 | WP_010847542.1 | CcdB family protein | Toxin |
XNC2_RS00380 | 83428..85506 | - | 2079 | WP_013183074.1 | plasmid pRiA4b ORF-3 family protein | - |
XNC2_RS00385 | 85490..85705 | - | 216 | WP_010847545.1 | hypothetical protein | - |
XNC2_RS20950 | 85743..86051 | + | 309 | WP_010847546.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11543.30 Da Isoelectric Point: 4.9756
>T285545 WP_010847542.1 NZ_LN681227:83020-83325 [Xenorhabdus nematophila AN6/1]
MQYTVYKNTGNPDYSYLLDVQSDIIDVLETRLVIPLFLKSNFHGRIPTRLCPTLNIDGNEYLVMTHAMASIRVSMLGDEM
TNVSSHRQLIKDAMDLLFDGF
MQYTVYKNTGNPDYSYLLDVQSDIIDVLETRLVIPLFLKSNFHGRIPTRLCPTLNIDGNEYLVMTHAMASIRVSMLGDEM
TNVSSHRQLIKDAMDLLFDGF
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|