Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 882704..883244 | Replicon | chromosome |
| Accession | NZ_LN681225 | ||
| Organism | Legionella hackeliae strain ATCC 35250 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0A8UM42 |
| Locus tag | LHA_RS04050 | Protein ID | WP_045105399.1 |
| Coordinates | 882704..883024 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A0A8UQY9 |
| Locus tag | LHA_RS04055 | Protein ID | WP_045105400.1 |
| Coordinates | 883011..883244 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LHA_RS04025 | 878121..879236 | - | 1116 | WP_045105394.1 | hypothetical protein | - |
| LHA_RS04030 | 879452..880309 | + | 858 | WP_045105395.1 | hypothetical protein | - |
| LHA_RS04035 | 880364..881467 | - | 1104 | WP_045105396.1 | hypothetical protein | - |
| LHA_RS04050 | 882704..883024 | - | 321 | WP_045105399.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LHA_RS04055 | 883011..883244 | - | 234 | WP_045105400.1 | hypothetical protein | Antitoxin |
| LHA_RS04060 | 884061..884402 | + | 342 | WP_082060279.1 | Tn3 family transposase | - |
| LHA_RS04065 | 884845..885550 | - | 706 | Protein_784 | transposase | - |
| LHA_RS15930 | 885869..886063 | + | 195 | WP_052673579.1 | hypothetical protein | - |
| LHA_RS16885 | 886115..886339 | + | 225 | WP_156413572.1 | hypothetical protein | - |
| LHA_RS04075 | 886787..887767 | - | 981 | WP_045105402.1 | serine/threonine protein kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11402.36 Da Isoelectric Point: 9.8716
>T285542 WP_045105399.1 NZ_LN681225:c883024-882704 [Legionella hackeliae]
MIRGDVYWVNLNPTTGSEINKERPCVLVSATPINKARRTVVVVPLSTSAKAIPPITVAVTCLGKQVVAVCDQIRTIDKSR
LMKSAGNLSASDLDKLDDGLRQVLSL
MIRGDVYWVNLNPTTGSEINKERPCVLVSATPINKARRTVVVVPLSTSAKAIPPITVAVTCLGKQVVAVCDQIRTIDKSR
LMKSAGNLSASDLDKLDDGLRQVLSL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8UM42 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8UQY9 |