Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1348419..1349335 | Replicon | chromosome |
| Accession | NZ_LN680001 | ||
| Organism | Bacillus subtilis strain BS34A | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | VV28_RS06835 | Protein ID | WP_003244695.1 |
| Coordinates | 1348589..1349335 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | VV28_RS06830 | Protein ID | WP_003232646.1 |
| Coordinates | 1348419..1348589 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VV28_RS06800 | 1345282..1345611 | + | 330 | WP_003232660.1 | phage-like element PBSX protein XkdW | - |
| VV28_RS06805 | 1345608..1345772 | + | 165 | WP_003232658.1 | XkdX family protein | - |
| VV28_RS06810 | 1345816..1346655 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
| VV28_RS06815 | 1346708..1346977 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| VV28_RS06820 | 1346990..1347253 | + | 264 | WP_003232653.1 | phage holin | - |
| VV28_RS06825 | 1347266..1348159 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| VV28_RS22350 | 1348196..1348333 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| VV28_RS06830 | 1348419..1348589 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| VV28_RS06835 | 1348589..1349335 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| VV28_RS06840 | 1349445..1350446 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| VV28_RS06845 | 1350459..1351076 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| VV28_RS06850 | 1351352..1352668 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
| VV28_RS06855 | 1353057..1354007 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| VV28_RS22355 | 1354108..1354254 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T285522 WP_003244695.1 NZ_LN680001:c1349335-1348589 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|