Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1348416..1349332 | Replicon | chromosome |
Accession | NZ_LN649259 | ||
Organism | Bacillus subtilis strain BS49 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | VV34_RS07155 | Protein ID | WP_003244695.1 |
Coordinates | 1348586..1349332 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | VV34_RS07150 | Protein ID | WP_003232646.1 |
Coordinates | 1348416..1348586 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VV34_RS07120 | 1345279..1345608 | + | 330 | WP_003232660.1 | phage-like element PBSX protein XkdW | - |
VV34_RS07125 | 1345605..1345769 | + | 165 | WP_003232658.1 | XkdX family protein | - |
VV34_RS07130 | 1345813..1346652 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
VV34_RS07135 | 1346705..1346974 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
VV34_RS07140 | 1346987..1347250 | + | 264 | WP_003232653.1 | phage holin | - |
VV34_RS07145 | 1347263..1348156 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
VV34_RS23555 | 1348193..1348330 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
VV34_RS07150 | 1348416..1348586 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
VV34_RS07155 | 1348586..1349332 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
VV34_RS07160 | 1349442..1350443 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
VV34_RS07165 | 1350456..1351073 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
VV34_RS07170 | 1351349..1352665 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
VV34_RS07175 | 1353054..1354004 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
VV34_RS23560 | 1354105..1354251 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T285501 WP_003244695.1 NZ_LN649259:c1349332-1348586 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|