Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2161334..2161863 Replicon chromosome
Accession NZ_LN626917
Organism Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1

Toxin (Protein)


Gene name mazF Uniprot ID Q6GF05
Locus tag SRS_RS11060 Protein ID WP_000621176.1
Coordinates 2161334..2161696 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag SRS_RS11065 Protein ID WP_000948331.1
Coordinates 2161693..2161863 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SRS_RS11035 2158312..2159082 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
SRS_RS11040 2159057..2159536 - 480 WP_001190825.1 anti-sigma B factor RsbW -
SRS_RS11045 2159538..2159864 - 327 WP_001052491.1 anti-sigma factor antagonist -
SRS_RS11050 2159983..2160984 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
SRS_RS11060 2161334..2161696 - 363 WP_000621176.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
SRS_RS11065 2161693..2161863 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
SRS_RS11070 2161948..2163096 - 1149 WP_001281140.1 alanine racemase -
SRS_RS11075 2163162..2163521 - 360 WP_000581197.1 holo-ACP synthase -
SRS_RS11080 2163525..2164016 - 492 WP_001286801.1 PH domain-containing protein -
SRS_RS11085 2164009..2165586 - 1578 Protein_2102 PH domain-containing protein -
SRS_RS11090 2165579..2166058 - 480 WP_001287082.1 hypothetical protein -
SRS_RS11095 2166267..2166827 - 561 WP_001092414.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13469.74 Da        Isoelectric Point: 10.1654

>T285495 WP_000621176.1 NZ_LN626917:c2161696-2161334 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT285495 WP_000948331.1 NZ_LN626917:c2161863-2161693 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A168PYX0

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References