Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2161334..2161863 | Replicon | chromosome |
Accession | NZ_LN626917 | ||
Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q6GF05 |
Locus tag | SRS_RS11060 | Protein ID | WP_000621176.1 |
Coordinates | 2161334..2161696 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | SRS_RS11065 | Protein ID | WP_000948331.1 |
Coordinates | 2161693..2161863 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRS_RS11035 | 2158312..2159082 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
SRS_RS11040 | 2159057..2159536 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
SRS_RS11045 | 2159538..2159864 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
SRS_RS11050 | 2159983..2160984 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
SRS_RS11060 | 2161334..2161696 | - | 363 | WP_000621176.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
SRS_RS11065 | 2161693..2161863 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
SRS_RS11070 | 2161948..2163096 | - | 1149 | WP_001281140.1 | alanine racemase | - |
SRS_RS11075 | 2163162..2163521 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
SRS_RS11080 | 2163525..2164016 | - | 492 | WP_001286801.1 | PH domain-containing protein | - |
SRS_RS11085 | 2164009..2165586 | - | 1578 | Protein_2102 | PH domain-containing protein | - |
SRS_RS11090 | 2165579..2166058 | - | 480 | WP_001287082.1 | hypothetical protein | - |
SRS_RS11095 | 2166267..2166827 | - | 561 | WP_001092414.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13469.74 Da Isoelectric Point: 10.1654
>T285495 WP_000621176.1 NZ_LN626917:c2161696-2161334 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVVHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A168PYX0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0VRZ1 |