Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1578470..1579267 Replicon chromosome
Accession NZ_LN626917
Organism Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag SRS_RS07925 Protein ID WP_045179173.1
Coordinates 1578806..1579267 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag SRS_RS07920 Protein ID WP_045179171.1
Coordinates 1578470..1578793 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SRS_RS07870 1573816..1574982 - 1167 WP_045179154.1 DUF2800 domain-containing protein -
SRS_RS07875 1574979..1575341 - 363 WP_045179157.1 hypothetical protein -
SRS_RS07880 1575356..1575679 - 324 WP_045179159.1 hypothetical protein -
SRS_RS07885 1575758..1575919 - 162 WP_000066017.1 DUF1270 domain-containing protein -
SRS_RS07890 1575931..1576194 - 264 WP_045179161.1 helix-turn-helix domain-containing protein -
SRS_RS07895 1576249..1576630 + 382 Protein_1531 DUF2513 domain-containing protein -
SRS_RS07900 1576617..1576814 - 198 WP_045179164.1 hypothetical protein -
SRS_RS07905 1576830..1577582 - 753 WP_045179166.1 phage antirepressor KilAC domain-containing protein -
SRS_RS07910 1577639..1577869 + 231 WP_045179168.1 hypothetical protein -
SRS_RS15710 1577866..1578042 - 177 WP_001001356.1 hypothetical protein -
SRS_RS07915 1578058..1578306 - 249 WP_000272859.1 helix-turn-helix domain-containing protein -
SRS_RS07920 1578470..1578793 + 324 WP_045179171.1 helix-turn-helix domain-containing protein Antitoxin
SRS_RS07925 1578806..1579267 + 462 WP_045179173.1 toxin Toxin
SRS_RS07930 1579284..1579716 + 433 Protein_1539 hypothetical protein -
SRS_RS07935 1579745..1580140 + 396 WP_001558060.1 hypothetical protein -
SRS_RS07940 1580229..1580375 + 147 WP_001795334.1 hypothetical protein -
SRS_RS07945 1580372..1580986 - 615 WP_000191466.1 hypothetical protein -
SRS_RS07950 1581112..1582317 + 1206 WP_045179176.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - gnd 1537246..1609289 72043


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18054.43 Da        Isoelectric Point: 4.6899

>T285492 WP_045179173.1 NZ_LN626917:1578806-1579267 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSIFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEHYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12489.13 Da        Isoelectric Point: 8.4338

>AT285492 WP_045179171.1 NZ_LN626917:1578470-1578793 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANELKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References