Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1578470..1579267 | Replicon | chromosome |
| Accession | NZ_LN626917 | ||
| Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | SRS_RS07925 | Protein ID | WP_045179173.1 |
| Coordinates | 1578806..1579267 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | SRS_RS07920 | Protein ID | WP_045179171.1 |
| Coordinates | 1578470..1578793 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SRS_RS07870 | 1573816..1574982 | - | 1167 | WP_045179154.1 | DUF2800 domain-containing protein | - |
| SRS_RS07875 | 1574979..1575341 | - | 363 | WP_045179157.1 | hypothetical protein | - |
| SRS_RS07880 | 1575356..1575679 | - | 324 | WP_045179159.1 | hypothetical protein | - |
| SRS_RS07885 | 1575758..1575919 | - | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| SRS_RS07890 | 1575931..1576194 | - | 264 | WP_045179161.1 | helix-turn-helix domain-containing protein | - |
| SRS_RS07895 | 1576249..1576630 | + | 382 | Protein_1531 | DUF2513 domain-containing protein | - |
| SRS_RS07900 | 1576617..1576814 | - | 198 | WP_045179164.1 | hypothetical protein | - |
| SRS_RS07905 | 1576830..1577582 | - | 753 | WP_045179166.1 | phage antirepressor KilAC domain-containing protein | - |
| SRS_RS07910 | 1577639..1577869 | + | 231 | WP_045179168.1 | hypothetical protein | - |
| SRS_RS15710 | 1577866..1578042 | - | 177 | WP_001001356.1 | hypothetical protein | - |
| SRS_RS07915 | 1578058..1578306 | - | 249 | WP_000272859.1 | helix-turn-helix domain-containing protein | - |
| SRS_RS07920 | 1578470..1578793 | + | 324 | WP_045179171.1 | helix-turn-helix domain-containing protein | Antitoxin |
| SRS_RS07925 | 1578806..1579267 | + | 462 | WP_045179173.1 | toxin | Toxin |
| SRS_RS07930 | 1579284..1579716 | + | 433 | Protein_1539 | hypothetical protein | - |
| SRS_RS07935 | 1579745..1580140 | + | 396 | WP_001558060.1 | hypothetical protein | - |
| SRS_RS07940 | 1580229..1580375 | + | 147 | WP_001795334.1 | hypothetical protein | - |
| SRS_RS07945 | 1580372..1580986 | - | 615 | WP_000191466.1 | hypothetical protein | - |
| SRS_RS07950 | 1581112..1582317 | + | 1206 | WP_045179176.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | gnd | 1537246..1609289 | 72043 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18054.43 Da Isoelectric Point: 4.6899
>T285492 WP_045179173.1 NZ_LN626917:1578806-1579267 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSIFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEHYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSIFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEHYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|