285488

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 787357..787834 Replicon chromosome
Accession NZ_LN626917
Organism Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag SRS_RS03850 Protein ID WP_000052076.1
Coordinates 787357..787545 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag SRS_RS03855 Protein ID WP_001059690.1
Coordinates 787574..787834 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SRS_RS03820 783310..783867 + 558 WP_045178710.1 hypothetical protein -
SRS_RS03825 784208..784894 + 687 WP_001574556.1 thermonuclease family protein -
SRS_RS03830 785251..785451 + 201 WP_001059082.1 cold-shock protein -
SRS_RS03835 785948..786166 - 219 WP_000005879.1 hypothetical protein -
SRS_RS03840 786228..786512 - 285 WP_001004401.1 hypothetical protein -
SRS_RS03845 786600..787169 - 570 WP_001106663.1 hypothetical protein -
SRS_RS03850 787357..787545 - 189 WP_000052076.1 hypothetical protein Toxin
SRS_RS03855 787574..787834 - 261 WP_001059690.1 hypothetical protein Antitoxin
SRS_RS03860 788175..788378 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
SRS_RS03865 788375..788611 - 237 WP_000368687.1 hypothetical protein -
SRS_RS03870 788835..789416 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
SRS_RS03875 789489..790106 - 618 WP_000255548.1 LysE/ArgO family amino acid transporter -
SRS_RS03880 790262..790756 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
SRS_RS03885 791155..791577 - 423 WP_000974455.1 organic hydroperoxide resistance protein -
SRS_RS03890 791725..792441 + 717 WP_000150025.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - tsst-1 / vWbp 758413..798167 39754


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T285488 WP_000052076.1 NZ_LN626917:c787545-787357 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT285488 WP_001059690.1 NZ_LN626917:c787834-787574 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References