Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 429461..429999 Replicon chromosome
Accession NZ_LN626917
Organism Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag SRS_RS02085 Protein ID WP_045178618.1
Coordinates 429673..429999 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag SRS_RS02080 Protein ID WP_045178617.1
Coordinates 429461..429670 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SRS_RS02055 424985..426526 + 1542 WP_000424963.1 glutamine-hydrolyzing GMP synthase -
SRS_RS02060 426620..427756 - 1137 WP_045178614.1 site-specific integrase -
SRS_RS02065 427840..428625 - 786 WP_045178615.1 helix-turn-helix domain-containing protein -
SRS_RS02070 428742..428969 + 228 WP_000494396.1 helix-turn-helix domain-containing protein -
SRS_RS02075 429015..429275 + 261 WP_000080597.1 hypothetical protein -
SRS_RS15695 429322..429468 + 147 WP_172643983.1 hypothetical protein -
SRS_RS02080 429461..429670 + 210 WP_045178617.1 hypothetical protein Antitoxin
SRS_RS02085 429673..429999 + 327 WP_045178618.1 DUF1474 family protein Toxin
SRS_RS02090 430064..430933 + 870 WP_045178619.1 primase alpha helix C-terminal domain-containing protein -
SRS_RS02095 430950..432407 + 1458 WP_045178620.1 virulence-associated E family protein -
SRS_RS02100 432708..433070 + 363 WP_045178622.1 hypothetical protein -
SRS_RS02105 433072..433356 + 285 WP_045178623.1 hypothetical protein -
SRS_RS02110 433353..433994 + 642 WP_045178624.1 pathogenicity island protein -
SRS_RS02115 434511..434852 + 342 WP_001190600.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 422188..443540 21352


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-100)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 13165.42 Da        Isoelectric Point: 4.5527

>T285487 WP_045178618.1 NZ_LN626917:429673-429999 [Staphylococcus aureus]
MNWEINDLFSDLKVLKDRFEDLKDNHGWHFEELYPHEPNHNLNKDELIREGFSYHERRIHNNQMFDLFHLYIEQFDNIIE
KFHEIEKASSENFGEESDDAKNSIKVAE

Download         Length: 327 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8237.34 Da        Isoelectric Point: 4.6311

>AT285487 WP_045178617.1 NZ_LN626917:429461-429670 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLKLSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References