Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 393618..394156 | Replicon | chromosome |
Accession | NZ_LN626917 | ||
Organism | Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | - |
Locus tag | SRS_RS01875 | Protein ID | WP_045178601.1 |
Coordinates | 393830..394156 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | - |
Locus tag | SRS_RS01870 | Protein ID | WP_045178599.1 |
Coordinates | 393618..393827 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SRS_RS01835 | 389827..390747 | - | 921 | Protein_358 | tyrosine-type recombinase/integrase | - |
SRS_RS01840 | 391026..391712 | - | 687 | WP_045178597.1 | helix-turn-helix domain-containing protein | - |
SRS_RS01845 | 391678..392202 | - | 525 | Protein_360 | SAP domain protein | - |
SRS_RS01850 | 392229..392801 | - | 573 | WP_001186980.1 | helix-turn-helix domain-containing protein | - |
SRS_RS01855 | 392973..393194 | + | 222 | WP_000560872.1 | helix-turn-helix domain-containing protein | - |
SRS_RS01860 | 393195..393467 | + | 273 | WP_000124597.1 | helix-turn-helix domain-containing protein | - |
SRS_RS01865 | 393479..393625 | + | 147 | WP_000784893.1 | hypothetical protein | - |
SRS_RS01870 | 393618..393827 | + | 210 | WP_045178599.1 | hypothetical protein | Antitoxin |
SRS_RS01875 | 393830..394156 | + | 327 | WP_045178601.1 | DUF1474 family protein | Toxin |
SRS_RS01880 | 394221..395090 | + | 870 | WP_045178602.1 | primase alpha helix C-terminal domain-containing protein | - |
SRS_RS01885 | 395104..396813 | + | 1710 | Protein_368 | DUF927 domain-containing protein | - |
SRS_RS01890 | 397124..397504 | + | 381 | WP_000356932.1 | hypothetical protein | - |
SRS_RS01895 | 397501..398142 | + | 642 | WP_045178603.1 | pathogenicity island protein | - |
SRS_RS01900 | 398490..398831 | + | 342 | WP_001190600.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 374227..408163 | 33936 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 13093.44 Da Isoelectric Point: 4.6496
>T285486 WP_045178601.1 NZ_LN626917:393830-394156 [Staphylococcus aureus]
MNLEINDLFSDLKLLKDRFEDLKDSHGWHFEELYPHEPNHNLNKDELIREGFSYHERRIHNNQMFDLFHLYIEQFDKIIE
KFHEIEKASSENFGEESDDAKNSIKVAE
MNLEINDLFSDLKLLKDRFEDLKDSHGWHFEELYPHEPNHNLNKDELIREGFSYHERRIHNNQMFDLFHLYIEQFDKIIE
KFHEIEKASSENFGEESDDAKNSIKVAE
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|