Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 393618..394156 Replicon chromosome
Accession NZ_LN626917
Organism Staphylococcus aureus strain ILRI_Eymole1/1 isolate Staphylococcus aureus isolate ILRI_Eymole1/1

Toxin (Protein)


Gene name TscT Uniprot ID -
Locus tag SRS_RS01875 Protein ID WP_045178601.1
Coordinates 393830..394156 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID -
Locus tag SRS_RS01870 Protein ID WP_045178599.1
Coordinates 393618..393827 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SRS_RS01835 389827..390747 - 921 Protein_358 tyrosine-type recombinase/integrase -
SRS_RS01840 391026..391712 - 687 WP_045178597.1 helix-turn-helix domain-containing protein -
SRS_RS01845 391678..392202 - 525 Protein_360 SAP domain protein -
SRS_RS01850 392229..392801 - 573 WP_001186980.1 helix-turn-helix domain-containing protein -
SRS_RS01855 392973..393194 + 222 WP_000560872.1 helix-turn-helix domain-containing protein -
SRS_RS01860 393195..393467 + 273 WP_000124597.1 helix-turn-helix domain-containing protein -
SRS_RS01865 393479..393625 + 147 WP_000784893.1 hypothetical protein -
SRS_RS01870 393618..393827 + 210 WP_045178599.1 hypothetical protein Antitoxin
SRS_RS01875 393830..394156 + 327 WP_045178601.1 DUF1474 family protein Toxin
SRS_RS01880 394221..395090 + 870 WP_045178602.1 primase alpha helix C-terminal domain-containing protein -
SRS_RS01885 395104..396813 + 1710 Protein_368 DUF927 domain-containing protein -
SRS_RS01890 397124..397504 + 381 WP_000356932.1 hypothetical protein -
SRS_RS01895 397501..398142 + 642 WP_045178603.1 pathogenicity island protein -
SRS_RS01900 398490..398831 + 342 WP_001190600.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 374227..408163 33936


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-100)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 13093.44 Da        Isoelectric Point: 4.6496

>T285486 WP_045178601.1 NZ_LN626917:393830-394156 [Staphylococcus aureus]
MNLEINDLFSDLKLLKDRFEDLKDSHGWHFEELYPHEPNHNLNKDELIREGFSYHERRIHNNQMFDLFHLYIEQFDKIIE
KFHEIEKASSENFGEESDDAKNSIKVAE

Download         Length: 327 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8220.25 Da        Isoelectric Point: 4.3718

>AT285486 WP_045178599.1 NZ_LN626917:393618-393827 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELILKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References