Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prpT-prpA/ParE-CC2985 |
Location | 140492..141032 | Replicon | plasmid II |
Accession | NZ_LN614828 | ||
Organism | Legionella fallonii LLAP-10 |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | A0A098G9U2 |
Locus tag | LFA_RS18090 | Protein ID | WP_045097841.1 |
Coordinates | 140492..140788 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PrpA | Uniprot ID | A0A098GB99 |
Locus tag | LFA_RS18095 | Protein ID | WP_045097842.1 |
Coordinates | 140778..141032 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LFA_RS18065 | 135598..135888 | + | 291 | WP_045097837.1 | helix-turn-helix domain-containing protein | - |
LFA_RS18070 | 135982..136311 | + | 330 | WP_045097838.1 | hypothetical protein | - |
LFA_RS18075 | 136696..137076 | - | 381 | WP_045097951.1 | nucleoside triphosphate hydrolase | - |
LFA_RS18080 | 137230..138732 | + | 1503 | WP_045097839.1 | DUF3987 domain-containing protein | - |
LFA_RS18085 | 139055..140362 | + | 1308 | WP_045097840.1 | hypothetical protein | - |
LFA_RS18090 | 140492..140788 | - | 297 | WP_045097841.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LFA_RS18095 | 140778..141032 | - | 255 | WP_045097842.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
LFA_RS18100 | 141250..142299 | - | 1050 | WP_045097843.1 | tyrosine-type recombinase/integrase | - |
LFA_RS18105 | 142456..143004 | + | 549 | WP_045097844.1 | ORF6N domain-containing protein | - |
LFA_RS18115 | 143129..144216 | + | 1088 | WP_157010461.1 | IS3 family transposase | - |
LFA_RS18120 | 144209..144553 | + | 345 | WP_045097846.1 | hypothetical protein | - |
LFA_RS19120 | 144675..145133 | + | 459 | WP_157010465.1 | DUF4156 domain-containing protein | - |
LFA_RS18130 | 145172..145393 | - | 222 | Protein_138 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..238761 | 238761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11765.52 Da Isoelectric Point: 7.3524
>T285484 WP_045097841.1 NZ_LN614828:c140788-140492 [Legionella fallonii LLAP-10]
MPNKTYRLYPKAIEDLESIYLYSMREFGIKRTEDYILTIETSFQYLADDPLISRTCDYVRQDLRAFNVGSHVIFFKMTHY
GIAVIRVLHQSMDFNRHF
MPNKTYRLYPKAIEDLESIYLYSMREFGIKRTEDYILTIETSFQYLADDPLISRTCDYVRQDLRAFNVGSHVIFFKMTHY
GIAVIRVLHQSMDFNRHF
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A098G9U2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A098GB99 |