Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 2336230..2336909 | Replicon | chromosome |
Accession | NZ_LN606600 | ||
Organism | Acetobacter senegalensis strain 108B |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A5B9GMW7 |
Locus tag | ASN_RS10885 | Protein ID | WP_058988177.1 |
Coordinates | 2336499..2336909 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ASN_RS10880 | Protein ID | WP_058988176.1 |
Coordinates | 2336230..2336502 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ASN_RS10850 | 2332855..2333535 | + | 681 | WP_058988170.1 | hypothetical protein | - |
ASN_RS10855 | 2333595..2333894 | + | 300 | WP_058988171.1 | hypothetical protein | - |
ASN_RS19965 | 2333887..2334033 | + | 147 | WP_162870764.1 | hypothetical protein | - |
ASN_RS10865 | 2334756..2335244 | + | 489 | WP_058988173.1 | single-stranded DNA-binding protein | - |
ASN_RS10870 | 2335307..2335744 | + | 438 | WP_058988174.1 | hypothetical protein | - |
ASN_RS10875 | 2335741..2336157 | + | 417 | WP_058988175.1 | hypothetical protein | - |
ASN_RS10880 | 2336230..2336502 | + | 273 | WP_058988176.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
ASN_RS10885 | 2336499..2336909 | + | 411 | WP_058988177.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ASN_RS10890 | 2336978..2337511 | + | 534 | WP_058988178.1 | hypothetical protein | - |
ASN_RS10895 | 2337508..2337708 | + | 201 | WP_006560470.1 | hypothetical protein | - |
ASN_RS18830 | 2337836..2338048 | + | 213 | WP_082666815.1 | hypothetical protein | - |
ASN_RS10900 | 2338143..2338535 | - | 393 | WP_058988179.1 | hypothetical protein | - |
ASN_RS10905 | 2338547..2339359 | - | 813 | WP_058988180.1 | hypothetical protein | - |
ASN_RS10910 | 2339456..2339920 | - | 465 | WP_058988181.1 | hypothetical protein | - |
ASN_RS10915 | 2339923..2340771 | - | 849 | WP_058988182.1 | hypothetical protein | - |
ASN_RS10920 | 2340888..2341709 | - | 822 | WP_099048371.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14787.09 Da Isoelectric Point: 5.2057
>T285463 WP_058988177.1 NZ_LN606600:2336499-2336909 [Acetobacter senegalensis]
VSAYLLDTNIISDLVRNPSGPCARRIERIDPGDLCTSIIVAAELRYGCAKKGSAKLLNRVESVLAFVPVLPLDIPADCEY
GGIRAELEAAGQTIGMNDLLIAAHAYTLKATLVTNNTREFMRIRGLKVENWLEDGT
VSAYLLDTNIISDLVRNPSGPCARRIERIDPGDLCTSIIVAAELRYGCAKKGSAKLLNRVESVLAFVPVLPLDIPADCEY
GGIRAELEAAGQTIGMNDLLIAAHAYTLKATLVTNNTREFMRIRGLKVENWLEDGT
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|