Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 909278..909807 | Replicon | chromosome |
Accession | NZ_LN554884 | ||
Organism | Staphylococcus xylosus strain C2a |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2T4NYG1 |
Locus tag | SXYL_RS04210 | Protein ID | WP_047172098.1 |
Coordinates | 909445..909807 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1D4YKY9 |
Locus tag | SXYL_RS04205 | Protein ID | WP_017722121.1 |
Coordinates | 909278..909448 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SXYL_RS04180 | 905055..905534 | + | 480 | WP_047172094.1 | PH domain-containing protein | - |
SXYL_RS04185 | 905527..907035 | + | 1509 | WP_047172095.1 | PH domain-containing protein | - |
SXYL_RS04190 | 907022..907513 | + | 492 | WP_047172096.1 | PH domain-containing protein | - |
SXYL_RS04195 | 907575..907928 | + | 354 | WP_042362337.1 | holo-ACP synthase | - |
SXYL_RS04200 | 908042..909190 | + | 1149 | WP_047172097.1 | alanine racemase | - |
SXYL_RS04205 | 909278..909448 | + | 171 | WP_017722121.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
SXYL_RS04210 | 909445..909807 | + | 363 | WP_047172098.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
SXYL_RS04215 | 910156..911157 | + | 1002 | WP_047172099.1 | PP2C family protein-serine/threonine phosphatase | - |
SXYL_RS04220 | 911237..911563 | + | 327 | WP_029377954.1 | anti-sigma factor antagonist | - |
SXYL_RS04225 | 911565..912047 | + | 483 | WP_029377953.1 | anti-sigma B factor RsbW | - |
SXYL_RS04230 | 912022..912792 | + | 771 | WP_047172100.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13551.81 Da Isoelectric Point: 10.3173
>T285458 WP_047172098.1 NZ_LN554884:909445-909807 [Staphylococcus xylosus]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSEKKMKEVNIAIDISLGLHNIRNHKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSEKKMKEVNIAIDISLGLHNIRNHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4NYG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D4YKY9 |