Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4476431..4477245 | Replicon | chromosome |
Accession | NZ_LM995446 | ||
Organism | Escherichia coli strain K-12 substr. RV308 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | ECRV308_RS22110 | Protein ID | WP_001054376.1 |
Coordinates | 4476988..4477245 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | ECRV308_RS22105 | Protein ID | WP_001309181.1 |
Coordinates | 4476431..4476976 (-) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECRV308_RS22085 | 4472122..4473435 | - | 1314 | WP_000460843.1 | galactitol-specific PTS transporter subunit IIC | - |
ECRV308_RS22090 | 4473447..4473725 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
ECRV308_RS22095 | 4473722..4474843 | - | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
ECRV308_RS25765 | 4475088..4475204 | - | 117 | Protein_4181 | VOC family protein | - |
ECRV308_RS25095 | 4475242..4475460 | - | 219 | Protein_4182 | hypothetical protein | - |
ECRV308_RS22100 | 4475629..4476375 | - | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
ECRV308_RS22105 | 4476431..4476976 | - | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
ECRV308_RS22110 | 4476988..4477245 | - | 258 | WP_001054376.1 | hypothetical protein | Toxin |
ECRV308_RS25555 | 4477622..4477867 | - | 246 | Protein_4186 | GNAT family N-acetyltransferase | - |
ECRV308_RS22125 | 4477983..4479223 | + | 1241 | Protein_4187 | helicase YjhR | - |
ECRV308_RS22130 | 4479806..4480786 | - | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
ECRV308_RS22135 | 4480851..4481957 | - | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | fimB / fimE | 4473722..4486601 | 12879 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T285452 WP_001054376.1 NZ_LM995446:c4477245-4476988 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT285452 WP_001309181.1 NZ_LM995446:c4476976-4476431 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|