Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2025167..2025998 | Replicon | chromosome |
| Accession | NZ_LM995446 | ||
| Organism | Escherichia coli strain K-12 substr. RV308 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | ECRV308_RS10220 | Protein ID | WP_000854814.1 |
| Coordinates | 2025624..2025998 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | ECRV308_RS10215 | Protein ID | WP_001285584.1 |
| Coordinates | 2025167..2025535 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECRV308_RS10200 | 2022834..2024366 | + | 1533 | WP_001350525.1 | hypothetical protein | - |
| ECRV308_RS24870 | 2024363..2024809 | + | 447 | WP_000187523.1 | RadC family protein | - |
| ECRV308_RS10210 | 2024872..2025093 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| ECRV308_RS10215 | 2025167..2025535 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| ECRV308_RS10220 | 2025624..2025998 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| ECRV308_RS10225 | 2025995..2026189 | + | 195 | WP_000988600.1 | hypothetical protein | - |
| ECRV308_RS25380 | 2026202..2026315 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| ECRV308_RS23715 | 2026604..2026732 | - | 129 | Protein_1950 | transposase domain-containing protein | - |
| ECRV308_RS10235 | 2026804..2026986 | + | 183 | WP_001016348.1 | hypothetical protein | - |
| ECRV308_RS10240 | 2027087..2027416 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| ECRV308_RS10245 | 2027588..2028646 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| ECRV308_RS10250 | 2028844..2029317 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| ECRV308_RS10255 | 2029436..2030602 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T285440 WP_000854814.1 NZ_LM995446:2025624-2025998 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT285440 WP_001285584.1 NZ_LM995446:2025167-2025535 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2E8G6 |