Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1458183..1458821 | Replicon | chromosome |
Accession | NZ_LM995446 | ||
Organism | Escherichia coli strain K-12 substr. RV308 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | ECRV308_RS07300 | Protein ID | WP_000813794.1 |
Coordinates | 1458183..1458359 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | ECRV308_RS07305 | Protein ID | WP_001270286.1 |
Coordinates | 1458405..1458821 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECRV308_RS07280 | 1453802..1455016 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
ECRV308_RS07285 | 1455069..1455605 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
ECRV308_RS07290 | 1455678..1457639 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
ECRV308_RS07295 | 1457731..1457961 | - | 231 | WP_000494244.1 | YncJ family protein | - |
ECRV308_RS07300 | 1458183..1458359 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
ECRV308_RS07305 | 1458405..1458821 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
ECRV308_RS07310 | 1458900..1460306 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
ECRV308_RS07315 | 1460551..1461696 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
ECRV308_RS07320 | 1461714..1462727 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
ECRV308_RS07325 | 1462728..1463669 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T285433 WP_000813794.1 NZ_LM995446:1458183-1458359 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT285433 WP_001270286.1 NZ_LM995446:1458405-1458821 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|