Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 443095..443713 | Replicon | chromosome |
| Accession | NZ_LM995446 | ||
| Organism | Escherichia coli strain K-12 substr. RV308 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | ECRV308_RS02220 | Protein ID | WP_001290581.1 |
| Coordinates | 443095..443313 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | ECRV308_RS02225 | Protein ID | WP_000344800.1 |
| Coordinates | 443339..443713 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECRV308_RS02190 | 438384..438956 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
| ECRV308_RS02195 | 438987..439298 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| ECRV308_RS02200 | 439677..440030 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| ECRV308_RS02205 | 440072..441622 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| ECRV308_RS02210 | 441786..442256 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| ECRV308_RS02215 | 442372..442923 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| ECRV308_RS02220 | 443095..443313 | - | 219 | WP_001290581.1 | hemolysin expression modulator Hha | Toxin |
| ECRV308_RS02225 | 443339..443713 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| ECRV308_RS02230 | 444259..447408 | - | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| ECRV308_RS02235 | 447431..448624 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8678.06 Da Isoelectric Point: 8.9008
>T285423 WP_001290581.1 NZ_LM995446:c443313-443095 [Escherichia coli]
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT285423 WP_000344800.1 NZ_LM995446:c443713-443339 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|