Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2028719..2029550 | Replicon | chromosome |
Accession | NZ_LM993812 | ||
Organism | Escherichia coli strain K-12 substr. HMS174 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | ECHMS174_RS10190 | Protein ID | WP_000854814.1 |
Coordinates | 2029176..2029550 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | P76364 |
Locus tag | ECHMS174_RS10185 | Protein ID | WP_001285584.1 |
Coordinates | 2028719..2029087 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECHMS174_RS10170 | 2026386..2027918 | + | 1533 | WP_001350525.1 | hypothetical protein | - |
ECHMS174_RS24890 | 2027915..2028361 | + | 447 | WP_000187523.1 | RadC family protein | - |
ECHMS174_RS10180 | 2028424..2028645 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
ECHMS174_RS10185 | 2028719..2029087 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
ECHMS174_RS10190 | 2029176..2029550 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
ECHMS174_RS10195 | 2029547..2029741 | + | 195 | WP_000988600.1 | hypothetical protein | - |
ECHMS174_RS25390 | 2029754..2029867 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
ECHMS174_RS23705 | 2030156..2030284 | - | 129 | Protein_1946 | transposase domain-containing protein | - |
ECHMS174_RS10205 | 2030356..2030538 | + | 183 | WP_001016348.1 | hypothetical protein | - |
ECHMS174_RS10210 | 2030639..2030968 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
ECHMS174_RS10215 | 2031140..2032198 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
ECHMS174_RS10220 | 2032396..2032869 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
ECHMS174_RS10225 | 2032988..2034154 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T285404 WP_000854814.1 NZ_LM993812:2029176-2029550 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT285404 WP_001285584.1 NZ_LM993812:2028719-2029087 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2H28 | |
AlphaFold DB | A0A1M2E8G6 |