Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1479246..1479884 | Replicon | chromosome |
Accession | NZ_LM993812 | ||
Organism | Escherichia coli strain K-12 substr. HMS174 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | ECHMS174_RS07345 | Protein ID | WP_000813794.1 |
Coordinates | 1479246..1479422 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | ECHMS174_RS07350 | Protein ID | WP_001270286.1 |
Coordinates | 1479468..1479884 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECHMS174_RS07325 | 1474865..1476079 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
ECHMS174_RS07330 | 1476132..1476668 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
ECHMS174_RS07335 | 1476741..1478702 | + | 1962 | WP_045152976.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
ECHMS174_RS07340 | 1478794..1479024 | - | 231 | WP_000494244.1 | YncJ family protein | - |
ECHMS174_RS07345 | 1479246..1479422 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
ECHMS174_RS07350 | 1479468..1479884 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
ECHMS174_RS07355 | 1479963..1481369 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
ECHMS174_RS07360 | 1481614..1482759 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
ECHMS174_RS07365 | 1482777..1483790 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
ECHMS174_RS07370 | 1483791..1484732 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T285397 WP_000813794.1 NZ_LM993812:1479246-1479422 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT285397 WP_001270286.1 NZ_LM993812:1479468-1479884 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|