Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 479313..479931 | Replicon | chromosome |
Accession | NZ_LM993812 | ||
Organism | Escherichia coli strain K-12 substr. HMS174 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | ECHMS174_RS02365 | Protein ID | WP_001291435.1 |
Coordinates | 479313..479531 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | ECHMS174_RS02370 | Protein ID | WP_000344800.1 |
Coordinates | 479557..479931 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECHMS174_RS02335 | 474602..475174 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
ECHMS174_RS02340 | 475205..475516 | - | 312 | WP_000409911.1 | MGMT family protein | - |
ECHMS174_RS02345 | 475895..476248 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
ECHMS174_RS02350 | 476290..477840 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
ECHMS174_RS02355 | 478004..478474 | - | 471 | WP_000136192.1 | YlaC family protein | - |
ECHMS174_RS02360 | 478590..479141 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
ECHMS174_RS02365 | 479313..479531 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
ECHMS174_RS02370 | 479557..479931 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
ECHMS174_RS02375 | 480477..483626 | - | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
ECHMS174_RS02380 | 483649..484842 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T285392 WP_001291435.1 NZ_LM993812:c479531-479313 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT285392 WP_000344800.1 NZ_LM993812:c479931-479557 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |