Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/Txe-RelB |
| Location | 1900242..1900771 | Replicon | chromosome |
| Accession | NZ_LK937696 | ||
| Organism | Coxiella burnetii Z3055 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | Q83AB3 |
| Locus tag | TY29_RS10075 | Protein ID | WP_005769718.1 |
| Coordinates | 1900496..1900771 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | Q83AB4 |
| Locus tag | TY29_RS10070 | Protein ID | WP_005769716.1 |
| Coordinates | 1900242..1900496 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TY29_RS10035 | 1895310..1895684 | + | 375 | WP_005769706.1 | hypothetical protein | - |
| TY29_RS10040 | 1895729..1896427 | + | 699 | WP_010958581.1 | outer membrane beta-barrel protein | - |
| TY29_RS10045 | 1896491..1897432 | + | 942 | WP_005769709.1 | S49 family peptidase | - |
| TY29_RS10050 | 1897445..1898320 | + | 876 | WP_017253342.1 | symmetrical bis(5'-nucleosyl)-tetraphosphatase | - |
| TY29_RS11615 | 1898296..1898409 | + | 114 | Protein_1936 | type II toxin-antitoxin system YoeB family toxin | - |
| TY29_RS10055 | 1898469..1898603 | + | 135 | WP_010958583.1 | hypothetical protein | - |
| TY29_RS10060 | 1898764..1899783 | + | 1020 | WP_041952483.1 | IS110-like element IS1111A family transposase | - |
| TY29_RS10065 | 1899780..1900052 | - | 273 | WP_010957319.1 | hypothetical protein | - |
| TY29_RS10070 | 1900242..1900496 | + | 255 | WP_005769716.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| TY29_RS10075 | 1900496..1900771 | + | 276 | WP_005769718.1 | Txe/YoeB family addiction module toxin | Toxin |
| TY29_RS10080 | 1900744..1901229 | - | 486 | WP_005769725.1 | dihydrofolate reductase | - |
| TY29_RS10085 | 1901226..1902029 | - | 804 | WP_017253341.1 | epoxyqueuosine reductase QueH | - |
| TY29_RS10090 | 1902225..1902512 | + | 288 | WP_005769730.1 | acylphosphatase | - |
| TY29_RS10095 | 1902488..1903042 | - | 555 | WP_005769732.1 | D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase | - |
| TY29_RS10100 | 1903055..1903999 | - | 945 | WP_010958586.1 | methionyl-tRNA formyltransferase | - |
| TY29_RS10105 | 1904187..1905113 | + | 927 | WP_040953450.1 | DNA-processing protein DprA | - |
| TY29_RS10110 | 1905110..1905589 | + | 480 | WP_010958588.1 | DUF494 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1898764..1899783 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 11150.86 Da Isoelectric Point: 9.6762
>T285388 WP_005769718.1 NZ_LK937696:1900496-1900771 [Coxiella burnetii Z3055]
MQISFTPEAWEDYLYWQKFDKKMLRRINELIKDAMHEPFSGKGKPEPLKFELQGYWSRRLDQEHRLVYKVLDDSLMIIAA
RFHYNRLNSKN
MQISFTPEAWEDYLYWQKFDKKMLRRINELIKDAMHEPFSGKGKPEPLKFELQGYWSRRLDQEHRLVYKVLDDSLMIIAA
RFHYNRLNSKN
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|