285388

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-yefM/Txe-RelB
Location 1900242..1900771 Replicon chromosome
Accession NZ_LK937696
Organism Coxiella burnetii Z3055

Toxin (Protein)


Gene name relE Uniprot ID Q83AB3
Locus tag TY29_RS10075 Protein ID WP_005769718.1
Coordinates 1900496..1900771 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q83AB4
Locus tag TY29_RS10070 Protein ID WP_005769716.1
Coordinates 1900242..1900496 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
TY29_RS10035 1895310..1895684 + 375 WP_005769706.1 hypothetical protein -
TY29_RS10040 1895729..1896427 + 699 WP_010958581.1 outer membrane beta-barrel protein -
TY29_RS10045 1896491..1897432 + 942 WP_005769709.1 S49 family peptidase -
TY29_RS10050 1897445..1898320 + 876 WP_017253342.1 symmetrical bis(5'-nucleosyl)-tetraphosphatase -
TY29_RS11615 1898296..1898409 + 114 Protein_1936 type II toxin-antitoxin system YoeB family toxin -
TY29_RS10055 1898469..1898603 + 135 WP_010958583.1 hypothetical protein -
TY29_RS10060 1898764..1899783 + 1020 WP_041952483.1 IS110-like element IS1111A family transposase -
TY29_RS10065 1899780..1900052 - 273 WP_010957319.1 hypothetical protein -
TY29_RS10070 1900242..1900496 + 255 WP_005769716.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
TY29_RS10075 1900496..1900771 + 276 WP_005769718.1 Txe/YoeB family addiction module toxin Toxin
TY29_RS10080 1900744..1901229 - 486 WP_005769725.1 dihydrofolate reductase -
TY29_RS10085 1901226..1902029 - 804 WP_017253341.1 epoxyqueuosine reductase QueH -
TY29_RS10090 1902225..1902512 + 288 WP_005769730.1 acylphosphatase -
TY29_RS10095 1902488..1903042 - 555 WP_005769732.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
TY29_RS10100 1903055..1903999 - 945 WP_010958586.1 methionyl-tRNA formyltransferase -
TY29_RS10105 1904187..1905113 + 927 WP_040953450.1 DNA-processing protein DprA -
TY29_RS10110 1905110..1905589 + 480 WP_010958588.1 DUF494 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1898764..1899783 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11150.86 Da        Isoelectric Point: 9.6762

>T285388 WP_005769718.1 NZ_LK937696:1900496-1900771 [Coxiella burnetii Z3055]
MQISFTPEAWEDYLYWQKFDKKMLRRINELIKDAMHEPFSGKGKPEPLKFELQGYWSRRLDQEHRLVYKVLDDSLMIIAA
RFHYNRLNSKN

Download         Length: 276 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9624.25 Da        Isoelectric Point: 10.4802

>AT285388 WP_005769716.1 NZ_LK937696:1900242-1900496 [Coxiella burnetii Z3055]
MNVVTFSELRAQLKKILDLSADQHEPVVVKRPNKETMVILSLRDFEALKETAYLLSNEANAARLRQSIRSLKQGKAQKKK
LMED

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q83AB3

Antitoxin

Source ID Structure
AlphaFold DB Q83AB4

References