Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 577943..578471 Replicon chromosome
Accession NZ_LK021129
Organism Vibrio anguillarum strain NB10

Toxin (Protein)


Gene name relE Uniprot ID F7YRA6
Locus tag VANGNB10_RS02960 Protein ID WP_013868556.1
Coordinates 577943..578230 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID F7YRA5
Locus tag VANGNB10_RS02965 Protein ID WP_013868555.1
Coordinates 578220..578471 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
VANGNB10_RS02935 572997..573464 - 468 WP_001289286.1 OsmC family protein -
VANGNB10_RS02940 573621..574061 - 441 WP_040122767.1 hypothetical protein -
VANGNB10_RS02945 574752..575111 - 360 WP_019281417.1 VOC family protein -
VANGNB10_RS02950 576311..576595 + 285 WP_017040620.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
VANGNB10_RS02955 576592..576870 + 279 WP_010320663.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
VANGNB10_RS02960 577943..578230 - 288 WP_013868556.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
VANGNB10_RS02965 578220..578471 - 252 WP_013868555.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
VANGNB10_RS02970 578685..579170 - 486 WP_107489895.1 hypothetical protein -
VANGNB10_RS02975 579417..580250 + 834 Protein_537 IS30-like element ISVa6 family transposase -
VANGNB10_RS02980 580333..580650 + 318 WP_011154648.1 IS66 family insertion sequence hypothetical protein -
VANGNB10_RS02985 580647..581000 + 354 WP_011154649.1 IS66 family insertion sequence element accessory protein TnpB -
VANGNB10_RS02990 581060..582601 + 1542 WP_011154650.1 IS66-like element ISVa5 family transposase -
VANGNB10_RS02995 582960..583235 - 276 WP_013868550.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - - 572414..584700 12286


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-70)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11064.07 Da        Isoelectric Point: 10.5506

>T285384 WP_013868556.1 NZ_LK021129:c578230-577943 [Vibrio anguillarum]
MTYKLKFLPAAKKEWSKLAPPIQSQFKKKLKERLENPHVPSSKLRGYDSVYKIKLRTAGYRLAYEVIDDEIVVYVLAIGK
RDKDAVYKKLASRFS

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9154.36 Da        Isoelectric Point: 4.0414

>AT285384 WP_013868555.1 NZ_LK021129:c578471-578220 [Vibrio anguillarum]
MRQVLADCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEFLMDMLDDYELAKLVESRRGELSEAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1E5BHG0

Antitoxin

Source ID Structure
AlphaFold DB A0A7X8TZB8

References