Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
| Location | 549730..550691 | Replicon | chromosome |
| Accession | NZ_LK021129 | ||
| Organism | Vibrio anguillarum strain NB10 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | F7YRB7 |
| Locus tag | VANGNB10_RS02825 | Protein ID | WP_013868567.1 |
| Coordinates | 549730..550263 (-) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | VANGNB10_RS20760 | Protein ID | WP_013868568.1 |
| Coordinates | 550260..550691 (-) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VANGNB10_RS02795 | 545399..545752 | - | 354 | WP_011154649.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| VANGNB10_RS02800 | 545749..546066 | - | 318 | WP_011154648.1 | IS66 family insertion sequence hypothetical protein | - |
| VANGNB10_RS02805 | 546224..546880 | - | 657 | WP_013868559.1 | hypothetical protein | - |
| VANGNB10_RS20205 | 546920..547036 | - | 117 | WP_080749045.1 | DUF3265 domain-containing protein | - |
| VANGNB10_RS02810 | 547033..547377 | - | 345 | WP_013868560.1 | hypothetical protein | - |
| VANGNB10_RS02815 | 547528..548076 | - | 549 | WP_019281391.1 | hypothetical protein | - |
| VANGNB10_RS20210 | 548130..548255 | - | 126 | WP_013868562.1 | DUF3265 domain-containing protein | - |
| VANGNB10_RS02820 | 548763..549044 | - | 282 | WP_029190024.1 | hypothetical protein | - |
| VANGNB10_RS02825 | 549730..550263 | - | 534 | WP_013868567.1 | GNAT family N-acetyltransferase | Toxin |
| VANGNB10_RS20760 | 550260..550691 | - | 432 | WP_013868568.1 | DUF1778 domain-containing protein | Antitoxin |
| VANGNB10_RS02835 | 551210..551725 | - | 516 | WP_013868571.1 | GNAT family N-acetyltransferase | - |
| VANGNB10_RS20225 | 551763..551855 | - | 93 | WP_072600976.1 | DUF3265 domain-containing protein | - |
| VANGNB10_RS02840 | 551970..552938 | + | 969 | WP_080749032.1 | IS30-like element ISVa6 family transposase | - |
| VANGNB10_RS02845 | 552980..553294 | - | 315 | WP_006073510.1 | hypothetical protein | - |
| VANGNB10_RS02850 | 553836..555269 | + | 1434 | Protein_514 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | qnrVC6 | - | 541158..552938 | 11780 | |
| - | inside | Integron | - | - | 541158..552938 | 11780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 20222.47 Da Isoelectric Point: 9.1188
>T285382 WP_013868567.1 NZ_LK021129:c550263-549730 [Vibrio anguillarum]
VSWGREFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSGQPLLNQKFAICAFYSVAPSSISRETLPT
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMYLPMKTVEQLFNQ
VSWGREFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSGQPLLNQKFAICAFYSVAPSSISRETLPT
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMYLPMKTVEQLFNQ
Download Length: 534 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15859.40 Da Isoelectric Point: 7.0831
>AT285382 WP_013868568.1 NZ_LK021129:c550691-550260 [Vibrio anguillarum]
VFTVCFLSSAVRCQPLSRALYSPSFRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLG
LKSLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
VFTVCFLSSAVRCQPLSRALYSPSFRKLSVRIECALSLAYNRSTDGMYPYAGGVMATARLDIRLDEEIKAKAEKASALLG
LKSLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|