Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /GNAT-DUF1778 |
Location | 475694..476460 | Replicon | chromosome |
Accession | NZ_LK021129 | ||
Organism | Vibrio anguillarum strain NB10 |
Toxin (Protein)
Gene name | - | Uniprot ID | F7YRS3 |
Locus tag | VANGNB10_RS02350 | Protein ID | WP_013867769.1 |
Coordinates | 475694..476191 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | F7YRS4 |
Locus tag | VANGNB10_RS02355 | Protein ID | WP_013867770.1 |
Coordinates | 476188..476460 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
VANGNB10_RS02325 | 472163..472516 | - | 354 | WP_011154649.1 | IS66 family insertion sequence element accessory protein TnpB | - |
VANGNB10_RS02330 | 472513..472830 | - | 318 | WP_011154648.1 | IS66 family insertion sequence hypothetical protein | - |
VANGNB10_RS20165 | 472945..473037 | + | 93 | WP_019281220.1 | DUF3265 domain-containing protein | - |
VANGNB10_RS20170 | 473125..473331 | + | 207 | WP_013867765.1 | DUF1289 domain-containing protein | - |
VANGNB10_RS02335 | 473451..473681 | - | 231 | WP_013867766.1 | PAS factor family protein | - |
VANGNB10_RS02340 | 473975..474211 | - | 237 | WP_013867767.1 | hypothetical protein | - |
VANGNB10_RS02345 | 474496..474984 | + | 489 | WP_013867768.1 | hypothetical protein | - |
VANGNB10_RS20575 | 474975..475106 | + | 132 | Protein_410 | DUF3265 domain-containing protein | - |
VANGNB10_RS02350 | 475694..476191 | - | 498 | WP_013867769.1 | GNAT family N-acetyltransferase | Toxin |
VANGNB10_RS02355 | 476188..476460 | - | 273 | WP_013867770.1 | DUF1778 domain-containing protein | Antitoxin |
VANGNB10_RS02365 | 477211..477930 | + | 720 | Protein_413 | hypothetical protein | - |
VANGNB10_RS02370 | 477987..478907 | - | 921 | WP_011154643.1 | IS5-like element ISVa2 family transposase | - |
VANGNB10_RS02375 | 479012..479299 | + | 288 | WP_157727321.1 | potassium channel family protein | - |
VANGNB10_RS02380 | 479325..480293 | - | 969 | WP_080749032.1 | IS30-like element ISVa6 family transposase | - |
VANGNB10_RS02385 | 480666..481055 | + | 390 | WP_019280976.1 | DUF1090 domain-containing protein | - |
VANGNB10_RS20180 | 481059..481148 | + | 90 | WP_019280977.1 | DUF3265 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integron | - | - | 436076..481055 | 44979 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18525.25 Da Isoelectric Point: 9.2555
>T285381 WP_013867769.1 NZ_LK021129:c476191-475694 [Vibrio anguillarum]
MMNTVLLDKVKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDNNSSHIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKYFYERYGFQAFQDAENKLFITIADV
RASLG
MMNTVLLDKVKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDNNSSHIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKYFYERYGFQAFQDAENKLFITIADV
RASLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Y3QZT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7X8U164 |