Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 492223..492815 | Replicon | chromosome |
Accession | NZ_LC127084 | ||
Organism | Edwardsiella tarda strain ET-1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D0ZEC2 |
Locus tag | SAMD00131843_RS02165 | Protein ID | WP_012847872.1 |
Coordinates | 492223..492426 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | D0ZEC3 |
Locus tag | SAMD00131843_RS02170 | Protein ID | WP_012847873.1 |
Coordinates | 492447..492815 (-) | Length | 123 a.a. |
Genomic Context
Location: 487886..488347 (462 bp)
Type: Others
Protein ID: WP_012847865.1
Type: Others
Protein ID: WP_012847865.1
Location: 488652..488990 (339 bp)
Type: Others
Protein ID: WP_012847867.1
Type: Others
Protein ID: WP_012847867.1
Location: 489012..490292 (1281 bp)
Type: Others
Protein ID: WP_041692495.1
Type: Others
Protein ID: WP_041692495.1
Location: 490327..491193 (867 bp)
Type: Others
Protein ID: WP_012847869.1
Type: Others
Protein ID: WP_012847869.1
Location: 491302..491658 (357 bp)
Type: Others
Protein ID: WP_012847870.1
Type: Others
Protein ID: WP_012847870.1
Location: 492223..492426 (204 bp)
Type: Toxin
Protein ID: WP_012847872.1
Type: Toxin
Protein ID: WP_012847872.1
Location: 492447..492815 (369 bp)
Type: Antitoxin
Protein ID: WP_012847873.1
Type: Antitoxin
Protein ID: WP_012847873.1
Location: 493183..496335 (3153 bp)
Type: Others
Protein ID: WP_012847874.1
Type: Others
Protein ID: WP_012847874.1
Location: 496379..497563 (1185 bp)
Type: Others
Protein ID: WP_012847875.1
Type: Others
Protein ID: WP_012847875.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAMD00131843_RS02130 | 487886..488347 | + | 462 | WP_012847865.1 | Lrp/AsnC family transcriptional regulator | - |
SAMD00131843_RS02135 | 488652..488990 | + | 339 | WP_012847867.1 | P-II family nitrogen regulator | - |
SAMD00131843_RS02140 | 489012..490292 | + | 1281 | WP_041692495.1 | ammonium transporter AmtB | - |
SAMD00131843_RS02145 | 490327..491193 | - | 867 | WP_012847869.1 | acyl-CoA thioesterase II | - |
SAMD00131843_RS02150 | 491302..491658 | - | 357 | WP_012847870.1 | MGMT family protein | - |
SAMD00131843_RS02165 | 492223..492426 | - | 204 | WP_012847872.1 | hemolysin expression modulator Hha | Toxin |
SAMD00131843_RS02170 | 492447..492815 | - | 369 | WP_012847873.1 | Hha toxicity modulator TomB | Antitoxin |
SAMD00131843_RS02175 | 493183..496335 | - | 3153 | WP_012847874.1 | multidrug efflux RND transporter permease subunit | - |
SAMD00131843_RS02180 | 496379..497563 | - | 1185 | WP_012847875.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8103.37 Da Isoelectric Point: 5.0914
>T285371 WP_012847872.1 NZ_LC127084:c492426-492223 [Edwardsiella tarda]
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14129.83 Da Isoelectric Point: 6.1484
>AT285371 WP_012847873.1 NZ_LC127084:c492815-492447 [Edwardsiella tarda]
MDEYTSYQHDIAELKYLCDSLYHQGIDVLGESHHGWVSDPTAKVNLQLNELIEHIASVAQSFKIKYPHHSDLAEILDDYL
DETYALFGAYSVSETALRHWLRTKRRVAYCLAHEKRNATLHV
MDEYTSYQHDIAELKYLCDSLYHQGIDVLGESHHGWVSDPTAKVNLQLNELIEHIASVAQSFKIKYPHHSDLAEILDDYL
DETYALFGAYSVSETALRHWLRTKRRVAYCLAHEKRNATLHV
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A034SMG4 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | D0ZEC3 |