Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 13494..14035 | Replicon | plasmid pXOCgx01 |
Accession | NZ_KR071788 | ||
Organism | Xanthomonas oryzae pv. oryzicola strain GX01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | XOCgx_RS22885 | Protein ID | WP_193566048.1 |
Coordinates | 13494..13820 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | XOCgx_RS22890 | Protein ID | WP_048485072.1 |
Coordinates | 13817..14035 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XOCgx_RS22875 | 8877..10451 | + | 1575 | WP_150411549.1 | type IV secretion system DNA-binding domain-containing protein | - |
XOCgx_RS22880 | 10465..13425 | + | 2961 | WP_048485071.1 | conjugative relaxase | - |
XOCgx_RS22885 | 13494..13820 | - | 327 | WP_193566048.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
XOCgx_RS22890 | 13817..14035 | - | 219 | WP_048485072.1 | antitoxin MazE family protein | Antitoxin |
XOCgx_RS22895 | 14254..14673 | - | 420 | WP_048485073.1 | hypothetical protein | - |
XOCgx_RS22900 | 14799..15707 | - | 909 | WP_048485074.1 | lytic transglycosylase domain-containing protein | - |
XOCgx_RS22905 | 15694..16716 | - | 1023 | WP_048485075.1 | P-type DNA transfer ATPase VirB11 | - |
XOCgx_RS22910 | 16727..17947 | - | 1221 | WP_048485076.1 | TrbI/VirB10 family protein | - |
XOCgx_RS22915 | 17949..18731 | - | 783 | WP_075244577.1 | P-type conjugative transfer protein VirB9 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..53206 | 53206 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11646.72 Da Isoelectric Point: 10.1008
>T285370 WP_193566048.1 NZ_KR071788:c13820-13494 [Xanthomonas oryzae pv. oryzicola]
MMRGDFVTIAMQGDFGKPRPALVIQADQFDAHTTVTVLPVTSTLVAAPLLRITVHPSTDNGLQKPSQVMVDKAMTVKRDK
VGRAFGRVDADALVVIERCLAVFLGIAK
MMRGDFVTIAMQGDFGKPRPALVIQADQFDAHTTVTVLPVTSTLVAAPLLRITVHPSTDNGLQKPSQVMVDKAMTVKRDK
VGRAFGRVDADALVVIERCLAVFLGIAK
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|