Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 4699812..4700181 Replicon chromosome
Accession NZ_HG999365
Organism Xanthomonas arboricola pv. juglandis isolate Xanthomonas arboricola pv. juglandis CPBF 765 isolated from C. illinoinensis

Toxin (Protein)


Gene name EcnB Uniprot ID -
Locus tag KHN80_RS20310 Protein ID WP_211914371.1
Coordinates 4699812..4699946 (-) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID V7Z8F2
Locus tag KHN80_RS20315 Protein ID WP_006451340.1
Coordinates 4700029..4700181 (-) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KHN80_RS20295 (XCY_004056) 4696878..4697822 - 945 WP_211914369.1 MBL fold metallo-hydrolase -
KHN80_RS20300 (XCY_004057) 4697880..4699169 - 1290 WP_211914370.1 tryptophan--tRNA ligase -
KHN80_RS20305 (XCY_004058) 4699352..4699561 - 210 WP_016904514.1 CsbD family protein -
KHN80_RS20310 (XCY_004059) 4699812..4699946 - 135 WP_211914371.1 entericidin A/B family lipoprotein Toxin
KHN80_RS20315 (XCY_004060) 4700029..4700181 - 153 WP_006451340.1 entericidin A/B family lipoprotein Antitoxin
KHN80_RS20320 (XCY_004061) 4700291..4701214 - 924 WP_047130143.1 arginase -
KHN80_RS20325 (XCY_004062) 4701690..4702142 + 453 WP_016904517.1 roadblock/LC7 domain-containing protein -
KHN80_RS20330 (XCY_004063) 4702206..4702565 + 360 WP_016904518.1 hypothetical protein -
KHN80_RS20335 (XCY_004064) 4702660..4703577 + 918 WP_039524754.1 hypothetical protein -
KHN80_RS20340 (XCY_004065) 4703574..4704116 + 543 WP_016904520.1 GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4457.29 Da        Isoelectric Point: 9.3487

>T285354 WP_211914371.1 NZ_HG999365:c4699946-4699812 [Xanthomonas arboricola pv. juglandis]
MKRAIVLLVLSLLSVGMLSGCNTVAGAGKDVQGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5168.11 Da        Isoelectric Point: 8.2782

>AT285354 WP_006451340.1 NZ_HG999365:c4700181-4700029 [Xanthomonas arboricola pv. juglandis]
MKRLLTLMVLGLFSAGVMTGCNTMAGAGKDMQGAGEKVEKKADNCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2N7V051

References