Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2716408..2717450 Replicon chromosome
Accession NZ_HG999365
Organism Xanthomonas arboricola pv. juglandis isolate Xanthomonas arboricola pv. juglandis CPBF 765 isolated from C. illinoinensis

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag KHN80_RS11750 Protein ID WP_014747691.1
Coordinates 2716408..2716911 (-) Length 168 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag KHN80_RS11755 Protein ID WP_003050245.1
Coordinates 2716980..2717450 (-) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KHN80_RS11725 (XCY_002343) 2712846..2713571 - 726 WP_003050273.1 CBASS effector endonuclease NucC -
KHN80_RS11730 (XCY_002344) 2713610..2714512 - 903 WP_003105624.1 CBASS oligonucleotide cyclase -
KHN80_RS11735 (XCY_002345) 2714512..2715012 - 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
KHN80_RS11740 (XCY_002346) 2715009..2715479 - 471 WP_003105626.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
KHN80_RS11745 (XCY_002347) 2715476..2716390 - 915 WP_003105629.1 AAA family ATPase -
KHN80_RS11750 (XCY_002348) 2716408..2716911 - 504 WP_014747691.1 PIN domain-containing protein Toxin
KHN80_RS11755 (XCY_002349) 2716980..2717450 - 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
KHN80_RS11760 (XCY_002350) 2717654..2718037 + 384 WP_003120001.1 RAQPRD family integrative conjugative element protein -
KHN80_RS11765 (XCY_002351) 2718034..2718267 + 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
KHN80_RS11770 (XCY_002352) 2718284..2718643 + 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
KHN80_RS11775 (XCY_002353) 2718655..2719053 + 399 WP_003105639.1 TIGR03750 family conjugal transfer protein -
KHN80_RS11780 (XCY_002354) 2719050..2719742 + 693 WP_003105641.1 TIGR03746 family integrating conjugative element protein -
KHN80_RS11785 (XCY_002355) 2719739..2720650 + 912 WP_003105643.1 TIGR03749 family integrating conjugative element protein -
KHN80_RS11790 (XCY_002356) 2720640..2722058 + 1419 WP_020924934.1 TIGR03752 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-90)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 168 a.a.        Molecular weight: 18879.55 Da        Isoelectric Point: 5.2622

>T285353 WP_014747691.1 NZ_HG999365:c2716911-2716408 [Xanthomonas arboricola pv. juglandis]
MWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGYEALVAGLTLPDPDDRHVLAAAIRC
GASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKHPPIEVDRYLEILLRQGLVQTTKVL
ATYRTIL

Download         Length: 504 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT285353 WP_003050245.1 NZ_HG999365:c2717450-2716980 [Xanthomonas arboricola pv. juglandis]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References