Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4721756..4722423 | Replicon | chromosome |
Accession | NZ_HG999364 | ||
Organism | Xanthomonas euroxanthea isolate Xanthomonas euroxanthea CPBF 766 isolated from C. illinoinensis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | KHO05_RS20105 | Protein ID | WP_212580445.1 |
Coordinates | 4722007..4722423 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | KHO05_RS20100 | Protein ID | WP_102582218.1 |
Coordinates | 4721756..4722010 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KHO05_RS20075 (XCY_004008) | 4717210..4718049 | + | 840 | WP_212580443.1 | SDR family oxidoreductase | - |
KHO05_RS20080 (XCY_004009) | 4718200..4719465 | + | 1266 | WP_164739643.1 | phospholipase D-like domain-containing protein | - |
KHO05_RS20085 (XCY_004010) | 4719508..4720044 | - | 537 | WP_104650609.1 | hypothetical protein | - |
KHO05_RS20090 (XCY_004011) | 4720313..4720519 | + | 207 | WP_212580444.1 | hypothetical protein | - |
KHO05_RS20095 (XCY_004012) | 4720506..4721618 | + | 1113 | WP_115678180.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KHO05_RS20100 (XCY_004013) | 4721756..4722010 | + | 255 | WP_102582218.1 | Arc family DNA-binding protein | Antitoxin |
KHO05_RS20105 (XCY_004014) | 4722007..4722423 | + | 417 | WP_212580445.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
KHO05_RS20110 | 4722404..4722550 | - | 147 | WP_212580446.1 | hypothetical protein | - |
KHO05_RS20115 (XCY_004015) | 4722550..4723110 | - | 561 | WP_212580447.1 | hypothetical protein | - |
KHO05_RS20120 (XCY_004016) | 4723787..4725412 | + | 1626 | WP_212580448.1 | alpha/beta hydrolase-fold protein | - |
KHO05_RS20125 (XCY_004017) | 4725509..4725910 | - | 402 | WP_212580449.1 | DUF2384 domain-containing protein | - |
KHO05_RS20130 (XCY_004018) | 4726215..4726670 | + | 456 | WP_181901323.1 | hypothetical protein | - |
KHO05_RS20135 (XCY_004019) | 4726699..4726986 | - | 288 | WP_115678184.1 | hypothetical protein | - |
KHO05_RS20140 (XCY_004020) | 4727122..4727367 | + | 246 | WP_010364309.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4721756..4736240 | 14484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14770.04 Da Isoelectric Point: 5.6845
>T285351 WP_212580445.1 NZ_HG999364:4722007-4722423 [Xanthomonas euroxanthea]
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFSTLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFSTLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|