Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 65633..66177 | Replicon | chromosome |
Accession | NZ_HG999364 | ||
Organism | Xanthomonas euroxanthea isolate Xanthomonas euroxanthea CPBF 766 isolated from C. illinoinensis |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | KHO05_RS00245 | Protein ID | WP_104585946.1 |
Coordinates | 65878..66177 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | KHO05_RS00240 | Protein ID | WP_104585948.1 |
Coordinates | 65633..65890 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KHO05_RS00230 (XCY_000046) | 62234..64729 | - | 2496 | WP_166766693.1 | DEAD/DEAH box helicase | - |
KHO05_RS00235 (XCY_000047) | 64903..65565 | + | 663 | WP_104585950.1 | hemolysin III family protein | - |
KHO05_RS00240 (XCY_000048) | 65633..65890 | + | 258 | WP_104585948.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
KHO05_RS00245 (XCY_000049) | 65878..66177 | + | 300 | WP_104585946.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KHO05_RS00250 (XCY_000050) | 66189..66707 | - | 519 | WP_244813217.1 | hypothetical protein | - |
KHO05_RS00255 (XCY_000051) | 66909..68006 | - | 1098 | WP_244813219.1 | ATP-grasp fold amidoligase family protein | - |
KHO05_RS00260 (XCY_000052) | 68347..68991 | + | 645 | WP_104650099.1 | glutathione S-transferase family protein | - |
KHO05_RS00265 (XCY_000053) | 69153..69860 | + | 708 | WP_212580481.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11316.00 Da Isoelectric Point: 9.0380
>T285349 WP_104585946.1 NZ_HG999364:65878-66177 [Xanthomonas euroxanthea]
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVVAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRRNRLSR
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVVAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRRNRLSR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|