Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4770412..4771079 | Replicon | chromosome |
Accession | NZ_HG999363 | ||
Organism | Xanthomonas euroxanthea isolate Xanthomonas euroxanthea CPBF 761 isolated from C. illinoinensis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | KHN77_RS20155 | Protein ID | WP_102582219.1 |
Coordinates | 4770663..4771079 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | KHN77_RS20150 | Protein ID | WP_102582218.1 |
Coordinates | 4770412..4770666 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KHN77_RS20125 (XCY_004026) | 4765868..4766707 | + | 840 | WP_119129942.1 | SDR family oxidoreductase | - |
KHN77_RS20130 (XCY_004027) | 4766858..4768123 | + | 1266 | WP_180496822.1 | phospholipase D-like domain-containing protein | - |
KHN77_RS20135 (XCY_004028) | 4768166..4768702 | - | 537 | WP_119129943.1 | hypothetical protein | - |
KHN77_RS20140 (XCY_004029) | 4768970..4769176 | + | 207 | WP_119129944.1 | hypothetical protein | - |
KHN77_RS20145 (XCY_004030) | 4769163..4770275 | + | 1113 | WP_119129945.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
KHN77_RS20150 (XCY_004031) | 4770412..4770666 | + | 255 | WP_102582218.1 | Arc family DNA-binding protein | Antitoxin |
KHN77_RS20155 (XCY_004032) | 4770663..4771079 | + | 417 | WP_102582219.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
KHN77_RS20160 (XCY_004033) | 4771204..4771764 | - | 561 | WP_104586335.1 | hypothetical protein | - |
KHN77_RS20165 (XCY_004034) | 4772462..4774087 | + | 1626 | WP_119129946.1 | alpha/beta hydrolase-fold protein | - |
KHN77_RS20170 (XCY_004035) | 4774170..4774571 | - | 402 | WP_126968946.1 | DUF2384 domain-containing protein | - |
KHN77_RS20175 (XCY_004036) | 4774876..4775331 | + | 456 | WP_180496823.1 | hypothetical protein | - |
KHN77_RS20180 (XCY_004037) | 4775360..4775683 | - | 324 | WP_119129948.1 | hypothetical protein | - |
KHN77_RS20185 (XCY_004038) | 4775795..4776040 | + | 246 | WP_115045825.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14754.04 Da Isoelectric Point: 5.6845
>T285348 WP_102582219.1 NZ_HG999363:4770663-4771079 [Xanthomonas euroxanthea]
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|