Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4346947..4347782 | Replicon | chromosome |
| Accession | NZ_HG994851 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q1R2L4 |
| Locus tag | LLO82_RS21095 | Protein ID | WP_001094426.1 |
| Coordinates | 4346947..4347324 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q1R2L5 |
| Locus tag | LLO82_RS21100 | Protein ID | WP_001285575.1 |
| Coordinates | 4347414..4347782 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO82_RS21070 (4342450) | 4342450..4342629 | + | 180 | Protein_4128 | peptidase | - |
| LLO82_RS21075 (4343028) | 4343028..4345064 | - | 2037 | WP_000417001.1 | hypothetical protein | - |
| LLO82_RS21080 (4346019) | 4346019..4346168 | - | 150 | Protein_4130 | hypothetical protein | - |
| LLO82_RS21085 (4346253) | 4346253..4346450 | - | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| LLO82_RS21090 (4346462) | 4346462..4346950 | - | 489 | WP_000761683.1 | DUF5983 family protein | - |
| LLO82_RS21095 (4346947) | 4346947..4347324 | - | 378 | WP_001094426.1 | TA system toxin CbtA family protein | Toxin |
| LLO82_RS21100 (4347414) | 4347414..4347782 | - | 369 | WP_001285575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LLO82_RS21105 (4347862) | 4347862..4348083 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| LLO82_RS21110 (4348170) | 4348170..4348646 | - | 477 | WP_001298074.1 | RadC family protein | - |
| LLO82_RS21115 (4348661) | 4348661..4349146 | - | 486 | WP_000213697.1 | antirestriction protein | - |
| LLO82_RS21120 (4349237) | 4349237..4350055 | - | 819 | WP_001175160.1 | DUF932 domain-containing protein | - |
| LLO82_RS21125 (4350145) | 4350145..4350378 | - | 234 | WP_001278290.1 | DUF905 family protein | - |
| LLO82_RS21130 (4350384) | 4350384..4351061 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| LLO82_RS21135 (4351209) | 4351209..4351889 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14072.99 Da Isoelectric Point: 7.3523
>T285336 WP_001094426.1 NZ_HG994851:c4347324-4346947 [Escherichia coli]
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13709.52 Da Isoelectric Point: 6.6258
>AT285336 WP_001285575.1 NZ_HG994851:c4347782-4347414 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABF5 |