Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4146639..4147189 Replicon chromosome
Accession NZ_HG994851
Organism Escherichia coli isolate 127

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag LLO82_RS20050 Protein ID WP_001160966.1
Coordinates 4146639..4146953 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag LLO82_RS20055 Protein ID WP_000125568.1
Coordinates 4146956..4147189 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLO82_RS20025 (4142314) 4142314..4143600 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
LLO82_RS20030 (4143600) 4143600..4144589 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
LLO82_RS20035 (4144586) 4144586..4145407 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
LLO82_RS20040 (4145410) 4145410..4145787 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
LLO82_RS20045 (4145794) 4145794..4146642 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
LLO82_RS20050 (4146639) 4146639..4146953 - 315 WP_001160966.1 CcdB family protein Toxin
LLO82_RS20055 (4146956) 4146956..4147189 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LLO82_RS20060 (4147275) 4147275..4147754 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
LLO82_RS20065 (4147946) 4147946..4149808 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
LLO82_RS20070 (4149801) 4149801..4150331 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
LLO82_RS20075 (4150439) 4150439..4151770 - 1332 WP_001183198.1 MFS transporter -
LLO82_RS20080 (4151829) 4151829..4152116 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T285330 WP_001160966.1 NZ_HG994851:c4146953-4146639 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT285330 WP_000125568.1 NZ_HG994851:c4147189-4146956 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References