Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3838882..3839717 | Replicon | chromosome |
| Accession | NZ_HG994851 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q83W73 |
| Locus tag | LLO82_RS18515 | Protein ID | WP_000854700.1 |
| Coordinates | 3838882..3839259 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | LLO82_RS18520 | Protein ID | WP_001278232.1 |
| Coordinates | 3839349..3839717 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO82_RS18485 (3834204) | 3834204..3834698 | + | 495 | WP_001059463.1 | MarR family transcriptional regulator | - |
| LLO82_RS18490 (3835136) | 3835136..3835471 | - | 336 | Protein_3624 | Arm DNA-binding domain-containing protein | - |
| LLO82_RS18495 (3835837) | 3835837..3837156 | + | 1320 | WP_000144686.1 | site-specific integrase | - |
| LLO82_RS18500 (3837249) | 3837249..3838103 | - | 855 | WP_024174313.1 | DUF4942 domain-containing protein | - |
| LLO82_RS18505 (3838188) | 3838188..3838385 | - | 198 | WP_000839247.1 | DUF957 domain-containing protein | - |
| LLO82_RS18510 (3838397) | 3838397..3838885 | - | 489 | WP_000761726.1 | DUF5983 family protein | - |
| LLO82_RS18515 (3838882) | 3838882..3839259 | - | 378 | WP_000854700.1 | TA system toxin CbtA family protein | Toxin |
| LLO82_RS18520 (3839349) | 3839349..3839717 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| LLO82_RS18525 (3839880) | 3839880..3840101 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| LLO82_RS18530 (3840170) | 3840170..3840646 | - | 477 | WP_001186199.1 | RadC family protein | - |
| LLO82_RS18535 (3840662) | 3840662..3841147 | - | 486 | WP_000213723.1 | antirestriction protein | - |
| LLO82_RS18540 (3841239) | 3841239..3842057 | - | 819 | WP_001234709.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE / vat | 3790946..3867619 | 76673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14276.28 Da Isoelectric Point: 7.8046
>T285328 WP_000854700.1 NZ_HG994851:c3839259-3838882 [Escherichia coli]
MKTLPDTHVREASRCLSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SPCTRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MKTLPDTHVREASRCLSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SPCTRSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT285328 WP_001278232.1 NZ_HG994851:c3839717-3839349 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A1I2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |