Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3648813..3649431 | Replicon | chromosome |
| Accession | NZ_HG994851 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | LLO82_RS17625 | Protein ID | WP_001291435.1 |
| Coordinates | 3649213..3649431 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | LLO82_RS17620 | Protein ID | WP_000344800.1 |
| Coordinates | 3648813..3649187 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO82_RS17610 (3643903) | 3643903..3645096 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LLO82_RS17615 (3645119) | 3645119..3648268 | + | 3150 | WP_001132481.1 | efflux RND transporter permease AcrB | - |
| LLO82_RS17620 (3648813) | 3648813..3649187 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| LLO82_RS17625 (3649213) | 3649213..3649431 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| LLO82_RS17630 (3649605) | 3649605..3650156 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| LLO82_RS17635 (3650272) | 3650272..3650742 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| LLO82_RS17640 (3650906) | 3650906..3652456 | + | 1551 | WP_001298569.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| LLO82_RS17645 (3652498) | 3652498..3652851 | - | 354 | WP_000878138.1 | DUF1428 family protein | - |
| LLO82_RS17655 (3653230) | 3653230..3653541 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| LLO82_RS17660 (3653572) | 3653572..3654144 | - | 573 | WP_000779830.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T285327 WP_001291435.1 NZ_HG994851:3649213-3649431 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT285327 WP_000344800.1 NZ_HG994851:3648813-3649187 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |