Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3139690..3140534 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | LLO82_RS15150 | Protein ID | WP_000854686.1 |
Coordinates | 3139690..3140073 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
Locus tag | LLO82_RS15155 | Protein ID | WP_001285602.1 |
Coordinates | 3140154..3140534 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS15120 (3136366) | 3136366..3137070 | + | 705 | WP_001241673.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
LLO82_RS15125 (3137355) | 3137355..3137573 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
LLO82_RS15135 (3138064) | 3138064..3138906 | - | 843 | WP_001431817.1 | DUF4942 domain-containing protein | - |
LLO82_RS15140 (3138991) | 3138991..3139188 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
LLO82_RS15145 (3139205) | 3139205..3139693 | - | 489 | WP_001054233.1 | DUF5983 family protein | - |
LLO82_RS15150 (3139690) | 3139690..3140073 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
LLO82_RS15155 (3140154) | 3140154..3140534 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LLO82_RS15160 (3140545) | 3140545..3141228 | - | 684 | WP_000086768.1 | hypothetical protein | - |
LLO82_RS15165 (3141247) | 3141247..3141468 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
LLO82_RS15170 (3141531) | 3141531..3142007 | - | 477 | WP_001186726.1 | RadC family protein | - |
LLO82_RS15175 (3142023) | 3142023..3142508 | - | 486 | WP_000214307.1 | antirestriction protein | - |
LLO82_RS15180 (3142600) | 3142600..3143418 | - | 819 | WP_001234732.1 | DUF932 domain-containing protein | - |
LLO82_RS15185 (3143518) | 3143518..3143751 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
LLO82_RS15190 (3143830) | 3143830..3144285 | - | 456 | WP_001504120.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T285324 WP_000854686.1 NZ_HG994851:c3140073-3139690 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT285324 WP_001285602.1 NZ_HG994851:c3140534-3140154 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|