Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1940023..1940854 Replicon chromosome
Accession NZ_HG994851
Organism Escherichia coli isolate 127

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag LLO82_RS09190 Protein ID WP_000854814.1
Coordinates 1940023..1940397 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag LLO82_RS09195 Protein ID WP_024174331.1
Coordinates 1940486..1940854 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLO82_RS09150 (1935419) 1935419..1936585 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
LLO82_RS09155 (1936704) 1936704..1937177 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
LLO82_RS09160 (1937375) 1937375..1938433 + 1059 WP_001200890.1 FUSC family protein -
LLO82_RS09165 (1938605) 1938605..1938934 + 330 WP_000450409.1 DUF496 family protein -
LLO82_RS09170 (1939035) 1939035..1939358 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
LLO82_RS09175 (1939337) 1939337..1939417 + 81 WP_023441679.1 hypothetical protein -
LLO82_RS09180 (1939706) 1939706..1939786 - 81 Protein_1802 hypothetical protein -
LLO82_RS09185 (1939832) 1939832..1940026 - 195 WP_000988601.1 DUF5983 family protein -
LLO82_RS09190 (1940023) 1940023..1940397 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LLO82_RS09195 (1940486) 1940486..1940854 - 369 WP_024174331.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LLO82_RS09200 (1940928) 1940928..1941149 - 222 WP_000692346.1 DUF987 domain-containing protein -
LLO82_RS09205 (1941218) 1941218..1941694 - 477 WP_001541535.1 RadC family protein -
LLO82_RS09210 (1941710) 1941710..1942183 - 474 WP_000855074.1 antirestriction protein -
LLO82_RS09215 (1942446) 1942446..1943267 - 822 WP_001234571.1 DUF932 domain-containing protein -
LLO82_RS09220 (1943488) 1943488..1943898 - 411 WP_000846704.1 hypothetical protein -
LLO82_RS09225 (1943914) 1943914..1944591 - 678 WP_001362823.1 hypothetical protein -
LLO82_RS09230 (1944727) 1944727..1945797 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T285317 WP_000854814.1 NZ_HG994851:c1940397-1940023 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13603.42 Da        Isoelectric Point: 6.7386

>AT285317 WP_024174331.1 NZ_HG994851:c1940854-1940486 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References