Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1129379..1129962 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | LLO82_RS05375 | Protein ID | WP_000254749.1 |
Coordinates | 1129627..1129962 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | LLO82_RS05370 | Protein ID | WP_000581937.1 |
Coordinates | 1129379..1129627 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS05360 (1125718) | 1125718..1127019 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
LLO82_RS05365 (1127067) | 1127067..1129301 | + | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
LLO82_RS05370 (1129379) | 1129379..1129627 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LLO82_RS05375 (1129627) | 1129627..1129962 | + | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
LLO82_RS05380 (1130034) | 1130034..1130825 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
LLO82_RS05385 (1131053) | 1131053..1132690 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
LLO82_RS05390 (1132778) | 1132778..1134076 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T285315 WP_000254749.1 NZ_HG994851:1129627-1129962 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|