Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 974177..974831 | Replicon | chromosome |
Accession | NZ_HG994851 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | LLO82_RS04755 | Protein ID | WP_000244765.1 |
Coordinates | 974424..974831 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | LLO82_RS04750 | Protein ID | WP_000354046.1 |
Coordinates | 974177..974443 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO82_RS04730 (970265) | 970265..971698 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
LLO82_RS04735 (971743) | 971743..972054 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
LLO82_RS04740 (972218) | 972218..972877 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
LLO82_RS04745 (972954) | 972954..973934 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
LLO82_RS04750 (974177) | 974177..974443 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
LLO82_RS04755 (974424) | 974424..974831 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
LLO82_RS04760 (974871) | 974871..975392 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
LLO82_RS04765 (975504) | 975504..976400 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LLO82_RS04770 (976425) | 976425..977135 | + | 711 | WP_000715229.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LLO82_RS04775 (977141) | 977141..978874 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T285314 WP_000244765.1 NZ_HG994851:974424-974831 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |