Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 830483..831315 | Replicon | chromosome |
| Accession | NZ_HG994851 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | LLO82_RS04020 | Protein ID | WP_000854753.1 |
| Coordinates | 830483..830857 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | LLO82_RS04025 | Protein ID | WP_001278232.1 |
| Coordinates | 830947..831315 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO82_RS03990 (825598) | 825598..826746 | - | 1149 | WP_000905914.1 | capsule polysaccharide transporter | - |
| LLO82_RS03995 (826818) | 826818..827801 | - | 984 | WP_001335608.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| LLO82_RS04000 (828611) | 828611..828781 | - | 171 | Protein_787 | IS110 family transposase | - |
| LLO82_RS04005 (829123) | 829123..829692 | - | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| LLO82_RS04010 (829789) | 829789..829986 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| LLO82_RS04015 (829998) | 829998..830486 | - | 489 | WP_000777541.1 | DUF5983 family protein | - |
| LLO82_RS04020 (830483) | 830483..830857 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| LLO82_RS04025 (830947) | 830947..831315 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| LLO82_RS04030 (831478) | 831478..831699 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| LLO82_RS04035 (831762) | 831762..832238 | - | 477 | WP_001186726.1 | RadC family protein | - |
| LLO82_RS04040 (832254) | 832254..832739 | - | 486 | WP_001531954.1 | antirestriction protein | - |
| LLO82_RS04045 (832794) | 832794..833615 | - | 822 | WP_202847156.1 | DUF932 domain-containing protein | - |
| LLO82_RS04050 (833794) | 833794..833883 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| LLO82_RS04055 (834026) | 834026..834481 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 828611..828715 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T285313 WP_000854753.1 NZ_HG994851:c830857-830483 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT285313 WP_001278232.1 NZ_HG994851:c831315-830947 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |