Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4399800..4400635 | Replicon | chromosome |
| Accession | NZ_HG994850 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q1R2L4 |
| Locus tag | LLO83_RS21305 | Protein ID | WP_001094426.1 |
| Coordinates | 4399800..4400177 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q1R2L5 |
| Locus tag | LLO83_RS21310 | Protein ID | WP_001285575.1 |
| Coordinates | 4400267..4400635 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO83_RS21280 (4395303) | 4395303..4395482 | + | 180 | Protein_4170 | peptidase | - |
| LLO83_RS21285 (4395881) | 4395881..4397917 | - | 2037 | WP_000417001.1 | hypothetical protein | - |
| LLO83_RS21290 (4398872) | 4398872..4399021 | - | 150 | Protein_4172 | hypothetical protein | - |
| LLO83_RS21295 (4399106) | 4399106..4399303 | - | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| LLO83_RS21300 (4399315) | 4399315..4399803 | - | 489 | WP_000761683.1 | DUF5983 family protein | - |
| LLO83_RS21305 (4399800) | 4399800..4400177 | - | 378 | WP_001094426.1 | TA system toxin CbtA family protein | Toxin |
| LLO83_RS21310 (4400267) | 4400267..4400635 | - | 369 | WP_001285575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LLO83_RS21315 (4400715) | 4400715..4400936 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| LLO83_RS21320 (4401023) | 4401023..4401499 | - | 477 | WP_001298074.1 | RadC family protein | - |
| LLO83_RS21325 (4401514) | 4401514..4401999 | - | 486 | WP_000213697.1 | antirestriction protein | - |
| LLO83_RS21330 (4402090) | 4402090..4402908 | - | 819 | WP_001175160.1 | DUF932 domain-containing protein | - |
| LLO83_RS21335 (4402998) | 4402998..4403231 | - | 234 | WP_001278290.1 | DUF905 family protein | - |
| LLO83_RS21340 (4403237) | 4403237..4403914 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| LLO83_RS21345 (4404062) | 4404062..4404742 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14072.99 Da Isoelectric Point: 7.3523
>T285308 WP_001094426.1 NZ_HG994850:c4400177-4399800 [Escherichia coli]
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13709.52 Da Isoelectric Point: 6.6258
>AT285308 WP_001285575.1 NZ_HG994850:c4400635-4400267 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABF5 |