Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4199492..4200042 Replicon chromosome
Accession NZ_HG994850
Organism Escherichia coli isolate 127

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag LLO83_RS20260 Protein ID WP_001160966.1
Coordinates 4199492..4199806 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag LLO83_RS20265 Protein ID WP_000125568.1
Coordinates 4199809..4200042 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLO83_RS20235 (4195167) 4195167..4196453 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
LLO83_RS20240 (4196453) 4196453..4197442 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
LLO83_RS20245 (4197439) 4197439..4198260 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
LLO83_RS20250 (4198263) 4198263..4198640 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
LLO83_RS20255 (4198647) 4198647..4199495 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
LLO83_RS20260 (4199492) 4199492..4199806 - 315 WP_001160966.1 CcdB family protein Toxin
LLO83_RS20265 (4199809) 4199809..4200042 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LLO83_RS20270 (4200128) 4200128..4200607 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
LLO83_RS20275 (4200799) 4200799..4202661 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
LLO83_RS20280 (4202654) 4202654..4203184 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
LLO83_RS20285 (4203292) 4203292..4204623 - 1332 WP_001183198.1 MFS transporter -
LLO83_RS20290 (4204682) 4204682..4204969 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T285302 WP_001160966.1 NZ_HG994850:c4199806-4199492 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT285302 WP_000125568.1 NZ_HG994850:c4200042-4199809 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References