Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 3163178..3164022 | Replicon | chromosome |
Accession | NZ_HG994850 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | LLO83_RS15240 | Protein ID | WP_000854686.1 |
Coordinates | 3163178..3163561 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
Locus tag | LLO83_RS15245 | Protein ID | WP_001285602.1 |
Coordinates | 3163642..3164022 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO83_RS15210 (3159854) | 3159854..3160558 | + | 705 | WP_001241673.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
LLO83_RS15215 (3160843) | 3160843..3161061 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
LLO83_RS15225 (3161552) | 3161552..3162394 | - | 843 | WP_001431817.1 | DUF4942 domain-containing protein | - |
LLO83_RS15230 (3162479) | 3162479..3162676 | - | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
LLO83_RS15235 (3162693) | 3162693..3163181 | - | 489 | WP_001054233.1 | DUF5983 family protein | - |
LLO83_RS15240 (3163178) | 3163178..3163561 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
LLO83_RS15245 (3163642) | 3163642..3164022 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LLO83_RS15250 (3164033) | 3164033..3164716 | - | 684 | WP_000086768.1 | hypothetical protein | - |
LLO83_RS15255 (3164735) | 3164735..3164956 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
LLO83_RS15260 (3165019) | 3165019..3165495 | - | 477 | WP_001186726.1 | RadC family protein | - |
LLO83_RS15265 (3165511) | 3165511..3165996 | - | 486 | WP_000214307.1 | antirestriction protein | - |
LLO83_RS15270 (3166088) | 3166088..3166906 | - | 819 | WP_001234732.1 | DUF932 domain-containing protein | - |
LLO83_RS15275 (3167006) | 3167006..3167239 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
LLO83_RS15280 (3167318) | 3167318..3167773 | - | 456 | WP_001504120.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T285296 WP_000854686.1 NZ_HG994850:c3163561-3163178 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT285296 WP_001285602.1 NZ_HG994850:c3164022-3163642 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|