Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1960379..1961210 Replicon chromosome
Accession NZ_HG994850
Organism Escherichia coli isolate 127

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag LLO83_RS09260 Protein ID WP_000854814.1
Coordinates 1960379..1960753 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag LLO83_RS09265 Protein ID WP_024174331.1
Coordinates 1960842..1961210 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLO83_RS09220 (1955775) 1955775..1956941 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
LLO83_RS09225 (1957060) 1957060..1957533 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
LLO83_RS09230 (1957731) 1957731..1958789 + 1059 WP_001200890.1 FUSC family protein -
LLO83_RS09235 (1958961) 1958961..1959290 + 330 WP_000450409.1 DUF496 family protein -
LLO83_RS09240 (1959391) 1959391..1959714 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
LLO83_RS09245 (1959693) 1959693..1959773 + 81 WP_023441679.1 hypothetical protein -
LLO83_RS09250 (1960062) 1960062..1960142 - 81 Protein_1816 hypothetical protein -
LLO83_RS09255 (1960188) 1960188..1960382 - 195 WP_000988601.1 DUF5983 family protein -
LLO83_RS09260 (1960379) 1960379..1960753 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LLO83_RS09265 (1960842) 1960842..1961210 - 369 WP_024174331.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LLO83_RS09270 (1961284) 1961284..1961505 - 222 WP_000692346.1 DUF987 domain-containing protein -
LLO83_RS09275 (1961574) 1961574..1962050 - 477 WP_001541535.1 RadC family protein -
LLO83_RS09280 (1962066) 1962066..1962539 - 474 WP_000855074.1 antirestriction protein -
LLO83_RS09285 (1962802) 1962802..1963623 - 822 WP_001234571.1 DUF932 domain-containing protein -
LLO83_RS09290 (1963844) 1963844..1964254 - 411 WP_000846704.1 hypothetical protein -
LLO83_RS09295 (1964270) 1964270..1964947 - 678 WP_001362823.1 hypothetical protein -
LLO83_RS09300 (1965083) 1965083..1966153 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T285289 WP_000854814.1 NZ_HG994850:c1960753-1960379 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13603.42 Da        Isoelectric Point: 6.7386

>AT285289 WP_024174331.1 NZ_HG994850:c1961210-1960842 [Escherichia coli]
VSDTLPGTTHPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References