Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 974955..975609 | Replicon | chromosome |
Accession | NZ_HG994850 | ||
Organism | Escherichia coli isolate 127 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | LLO83_RS04755 | Protein ID | WP_000244765.1 |
Coordinates | 975202..975609 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | LLO83_RS04750 | Protein ID | WP_000354046.1 |
Coordinates | 974955..975221 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLO83_RS04730 (971043) | 971043..972476 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
LLO83_RS04735 (972521) | 972521..972832 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
LLO83_RS04740 (972996) | 972996..973655 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
LLO83_RS04745 (973732) | 973732..974712 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
LLO83_RS04750 (974955) | 974955..975221 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
LLO83_RS04755 (975202) | 975202..975609 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
LLO83_RS04760 (975649) | 975649..976170 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
LLO83_RS04765 (976282) | 976282..977178 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LLO83_RS04770 (977203) | 977203..977913 | + | 711 | WP_000715229.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LLO83_RS04775 (977919) | 977919..979652 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T285286 WP_000244765.1 NZ_HG994850:975202-975609 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |