Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 831261..832093 | Replicon | chromosome |
| Accession | NZ_HG994850 | ||
| Organism | Escherichia coli isolate 127 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | LLO83_RS04020 | Protein ID | WP_000854753.1 |
| Coordinates | 831261..831635 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LLO83_RS04025 | Protein ID | WP_001531802.1 |
| Coordinates | 831725..832093 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLO83_RS03990 (826819) | 826819..827802 | - | 984 | WP_001335608.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| LLO83_RS04000 (829389) | 829389..829559 | - | 171 | Protein_787 | IS110 family transposase | - |
| LLO83_RS04005 (829901) | 829901..830470 | - | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| LLO83_RS04010 (830567) | 830567..830764 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| LLO83_RS04015 (830776) | 830776..831264 | - | 489 | WP_000777541.1 | DUF5983 family protein | - |
| LLO83_RS04020 (831261) | 831261..831635 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| LLO83_RS04025 (831725) | 831725..832093 | - | 369 | WP_001531802.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LLO83_RS04030 (832256) | 832256..832477 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| LLO83_RS04035 (832540) | 832540..833016 | - | 477 | WP_001186726.1 | RadC family protein | - |
| LLO83_RS04040 (833032) | 833032..833517 | - | 486 | WP_001531954.1 | antirestriction protein | - |
| LLO83_RS04045 (833572) | 833572..834393 | - | 822 | WP_202847156.1 | DUF932 domain-containing protein | - |
| LLO83_RS04050 (834572) | 834572..834661 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| LLO83_RS04055 (834804) | 834804..835259 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T285285 WP_000854753.1 NZ_HG994850:c831635-831261 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13422.27 Da Isoelectric Point: 6.3161
>AT285285 WP_001531802.1 NZ_HG994850:c832093-831725 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNSLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNSLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|