Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2017395..2018158 | Replicon | chromosome |
| Accession | NZ_HG992758 | ||
| Organism | Vibrio sp. B1FLJ16 isolate B1REV17 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A919BFZ0 |
| Locus tag | KHN94_RS09160 | Protein ID | WP_023584043.1 |
| Coordinates | 2017652..2018158 (+) | Length | 169 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | KHN94_RS09155 | Protein ID | WP_000212004.1 |
| Coordinates | 2017395..2017661 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHN94_RS09145 (ACOMICROBIO_EPCKBFOG_01869) | 2012744..2013853 | - | 1110 | WP_182029135.1 | hypothetical protein | - |
| KHN94_RS09150 (ACOMICROBIO_LOCUS1317) | 2013850..2016579 | - | 2730 | WP_182029137.1 | DEAD/DEAH box helicase | - |
| KHN94_RS09155 (ACOMICROBIO_LOCUS1318) | 2017395..2017661 | + | 267 | WP_000212004.1 | DUF1778 domain-containing protein | Antitoxin |
| KHN94_RS09160 (ACOMICROBIO_LOCUS1319) | 2017652..2018158 | + | 507 | WP_023584043.1 | GNAT family N-acetyltransferase | Toxin |
| KHN94_RS09165 (ACOMICROBIO_EPCKBFOG_01873) | 2018199..2018585 | - | 387 | WP_000180225.1 | TraA family conjugative transfer protein | - |
| KHN94_RS09170 (ACOMICROBIO_EPCKBFOG_01874) | 2018582..2019154 | - | 573 | WP_001944091.1 | type IV conjugative transfer system lipoprotein TraV | - |
| KHN94_RS09175 (ACOMICROBIO_EPCKBFOG_01875) | 2019229..2020518 | - | 1290 | WP_182029139.1 | TraB/VirB10 family protein | - |
| KHN94_RS09180 (ACOMICROBIO_EPCKBFOG_01876) | 2020521..2021417 | - | 897 | WP_182029237.1 | type-F conjugative transfer system secretin TraK | - |
| KHN94_RS09185 (ACOMICROBIO_EPCKBFOG_01877) | 2021401..2022027 | - | 627 | WP_000667170.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| KHN94_RS09190 (ACOMICROBIO_EPCKBFOG_01878) | 2022024..2022305 | - | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1952409..2046621 | 94212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18278.00 Da Isoelectric Point: 7.2132
>T285282 WP_023584043.1 NZ_HG992758:2017652-2018158 [Vibrio sp. B1FLJ16]
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
MGISAPTLLTDEHQLNAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDGSAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|