Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
| Location | 1824116..1824681 | Replicon | chromosome |
| Accession | NZ_HG992758 | ||
| Organism | Vibrio sp. B1FLJ16 isolate B1REV17 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7X8U0A9 |
| Locus tag | KHN94_RS08305 | Protein ID | WP_029865673.1 |
| Coordinates | 1824116..1824403 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | KHN94_RS08310 | Protein ID | WP_182032589.1 |
| Coordinates | 1824400..1824681 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHN94_RS08285 (ACOMICROBIO_LOCUS1208) | 1820488..1821180 | + | 693 | WP_182011762.1 | NAD(P)H-binding protein | - |
| KHN94_RS08290 (ACOMICROBIO_LOCUS1209) | 1821370..1822749 | + | 1380 | WP_182032573.1 | L-cystine transporter | - |
| KHN94_RS08295 (ACOMICROBIO_EPCKBFOG_01699) | 1823109..1823462 | - | 354 | WP_182011760.1 | DUF1428 domain-containing protein | - |
| KHN94_RS08300 | 1823586..1823717 | + | 132 | Protein_1609 | IS110 family transposase | - |
| KHN94_RS08305 (ACOMICROBIO_EPCKBFOG_01700) | 1824116..1824403 | - | 288 | WP_029865673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KHN94_RS08310 (ACOMICROBIO_LOCUS1210) | 1824400..1824681 | - | 282 | WP_182032589.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KHN94_RS08315 (ACOMICROBIO_LOCUS1211) | 1824835..1825860 | + | 1026 | WP_211910496.1 | IS110 family transposase | - |
| KHN94_RS08320 (ACOMICROBIO_LOCUS1212) | 1826216..1827220 | - | 1005 | WP_182028970.1 | LD-carboxypeptidase | - |
| KHN94_RS08325 (ACOMICROBIO_LOCUS1213) | 1827477..1828439 | + | 963 | WP_182028972.1 | integron integrase | - |
| KHN94_RS08330 (ACOMICROBIO_EPCKBFOG_01705) | 1828498..1828971 | - | 474 | WP_182008310.1 | DUF2947 domain-containing protein | - |
| KHN94_RS08335 (ACOMICROBIO_EPCKBFOG_01706) | 1828985..1829572 | - | 588 | WP_182008311.1 | HD domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1824835..1825860 | 1025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10993.65 Da Isoelectric Point: 5.1098
>T285281 WP_029865673.1 NZ_HG992758:c1824403-1824116 [Vibrio sp. B1FLJ16]
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|